OSCA025874-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025874-RA
Unique NameOSCA025874-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length71
Homology
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|357630243|gb|EHJ78503.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 111.309 bits (277), Expect = 7.375e-27
Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 0
Query:    4 DDPIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
            + PID QIKRRKW WI H LRRDP+HIPKQALDW+P+GKRKRGR +QTWRRT+  E K IGKTWS+IK
Sbjct:  744 ETPIDLQIKRRKWKWIGHALRRDPEHIPKQALDWTPEGKRKRGRPKQTWRRTIIAEVKNIGKTWSDIK 811          
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|357617567|gb|EHJ70865.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 110.153 bits (274), Expect = 1.469e-26
Identity = 50/68 (73.53%), Postives = 58/68 (85.29%), Query Frame = 0
Query:    4 DDPIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
            + PID QIKRRKW WI H LRRDP+HIP+QALDW+P+GKRKRGR +QTWRRT+  E K IGKTWS+IK
Sbjct:  485 ETPIDLQIKRRKWKWIGHALRRDPEHIPRQALDWTPEGKRKRGRPKQTWRRTIIAEVKNIGKTWSDIK 552          
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|357611138|gb|EHJ67327.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 97.4413 bits (241), Expect = 1.680e-24
Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = 0
Query:    6 PIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
            PID QIKRRKW WI HTLRR+P++IPKQALDW+PQGK K GR +QTWRRT+  E K IGK W+++K
Sbjct:   45 PIDLQIKRRKWKWIGHTLRREPEYIPKQALDWTPQGKLKCGRPKQTWRRTIIVEVKNIGKIWNDMK 110          
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|1070597774|ref|XP_018396130.1| (PREDICTED: uncharacterized protein LOC108774498 [Cyphomyrmex costatus])

HSP 1 Score: 88.1965 bits (217), Expect = 1.634e-20
Identity = 39/70 (55.71%), Postives = 53/70 (75.71%), Query Frame = 0
Query:    2 GKDDPIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
             K + ID +I+RRKW WI HTLR+DP +I + A++++PQGKRK GR   +WRRT+ +E K IGK W+EIK
Sbjct:   64 SKQEKIDTEIRRRKWKWIGHTLRKDPHNITRMAMEYNPQGKRKTGRSAMSWRRTIDNEIKSIGKCWTEIK 133          
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|929334205|ref|XP_014046915.1| (PREDICTED: uncharacterized protein LOC106600097, partial [Salmo salar])

HSP 1 Score: 85.8853 bits (211), Expect = 2.134e-18
Identity = 40/65 (61.54%), Postives = 49/65 (75.38%), Query Frame = 0
Query:    7 IDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
            I+  IK+RKW WI HTLR+ P ++ +QALDW+PQGKRK GR RQTWRR+   E K  G TW+EIK
Sbjct:  238 IEVDIKKRKWGWIGHTLRKSPSNVTRQALDWNPQGKRKVGRPRQTWRRSTDAEVKAAGMTWAEIK 302          
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|732626515|gb|JAG28653.1| (Putative uncharacterized transposon-derived protein F52C9.6, partial [Lygus hesperus])

HSP 1 Score: 81.6481 bits (200), Expect = 2.198e-18
Identity = 35/66 (53.03%), Postives = 51/66 (77.27%), Query Frame = 0
Query:    6 PIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
            PI  ++KRRKW WI HTLR+    + ++AL+W+PQG R+RGR R TWRR++  EA K+GK+W++I+
Sbjct:   39 PIAVEVKRRKWQWIGHTLRKGEGAVEQEALEWNPQGYRRRGRPRMTWRRSIEVEAAKVGKSWNQIR 104          
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|743584582|gb|JAG65549.1| (hypothetical protein, partial [Lygus hesperus])

HSP 1 Score: 82.0333 bits (201), Expect = 3.438e-18
Identity = 38/66 (57.58%), Postives = 48/66 (72.73%), Query Frame = 0
Query:    6 PIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
            PI  +I +RKW W+ HTLR+D   I K+ALDW+PQG R RGR R TWRR+V  EA + GK+W E+K
Sbjct:   75 PISSEIMKRKWKWVGHTLRKDELSIEKKALDWNPQGYRGRGRPRTTWRRSVEAEAGRAGKSWQEVK 140          
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|762166361|ref|XP_011421492.1| (PREDICTED: uncharacterized protein LOC105324135, partial [Crassostrea gigas])

HSP 1 Score: 80.4925 bits (197), Expect = 8.416e-18
Identity = 40/69 (57.97%), Postives = 52/69 (75.36%), Query Frame = 0
Query:    3 KDDPIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
            K DPI  +IKRRKW W  HT+R+ P++I +QALDW+P+GK K GR RQT RR+V  E KK G TW+++K
Sbjct:   51 KQDPIHIEIKRRKWGWRGHTIRKSPENITRQALDWNPKGKGKVGRPRQTLRRSVESEEKKKGFTWAKLK 119          
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|1009377295|gb|KYN00607.1| (hypothetical protein ALC62_08617 [Cyphomyrmex costatus])

HSP 1 Score: 83.9593 bits (206), Expect = 1.904e-17
Identity = 38/70 (54.29%), Postives = 52/70 (74.29%), Query Frame = 0
Query:    2 GKDDPIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
             K + I  +I+RRKW WI HTLR+D  +I   A++++PQGKRKRGR   +WRRT+ +E K IGK+W+EIK
Sbjct:  327 SKQEKIGTEIRRRKWKWIGHTLRKDSHNIAHMAMEYNPQGKRKRGRPAMSWRRTIDNEIKPIGKSWAEIK 396          
BLAST of OSCA025874-RA vs. genbank:protein
Match: gi|743547268|gb|JAG49394.1| (hypothetical protein, partial [Lygus hesperus])

HSP 1 Score: 84.3445 bits (207), Expect = 2.028e-17
Identity = 39/69 (56.52%), Postives = 51/69 (73.91%), Query Frame = 0
Query:    3 KDDPIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQTWRRTVADEAKKIGKTWSEIK 71
            K  PI   I++RKW WI HTLR++ D + ++ALDW+PQG R+ GR R+TWRR+V +EA   GKTWS IK
Sbjct:  471 KQSPIATDIRKRKWKWIGHTLRKNEDSVERRALDWNPQGSRRIGRPRKTWRRSVEEEASSAGKTWSGIK 539          
The following BLAST results are available for this feature:
BLAST of OSCA025874-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357630243|gb|EHJ78503.1|7.375e-2775.00endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357617567|gb|EHJ70865.1|1.469e-2673.53endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357611138|gb|EHJ67327.1|1.680e-2469.70endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|1070597774|ref|XP_018396130.1|1.634e-2055.71PREDICTED: uncharacterized protein LOC108774498 [C... [more]
gi|929334205|ref|XP_014046915.1|2.134e-1861.54PREDICTED: uncharacterized protein LOC106600097, p... [more]
gi|732626515|gb|JAG28653.1|2.198e-1853.03Putative uncharacterized transposon-derived protei... [more]
gi|743584582|gb|JAG65549.1|3.438e-1857.58hypothetical protein, partial [Lygus hesperus][more]
gi|762166361|ref|XP_011421492.1|8.416e-1857.97PREDICTED: uncharacterized protein LOC105324135, p... [more]
gi|1009377295|gb|KYN00607.1|1.904e-1754.29hypothetical protein ALC62_08617 [Cyphomyrmex cost... [more]
gi|743547268|gb|JAG49394.1|2.028e-1756.52hypothetical protein, partial [Lygus hesperus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_10973contignewscf_10973:7967..8179 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025874-RAOSCA025874-RAOstrinia scapulalismRNAnewscf_10973 7967..8179 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025874-PA ID=OSCA025874-PA|Name=OSCA025874-RA|organism=Ostrinia scapulalis|type=polypeptide|length=71bp
MGKDDPIDQQIKRRKWNWIDHTLRRDPDHIPKQALDWSPQGKRKRGRLRQ
TWRRTVADEAKKIGKTWSEIK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity