OSCA025875-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025875-RA
Unique NameOSCA025875-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length76
Homology
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|930681616|gb|KPJ21156.1| (Octopamine receptor [Papilio machaon])

HSP 1 Score: 164.081 bits (414), Expect = 2.808e-47
Identity = 72/76 (94.74%), Postives = 74/76 (97.37%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            KWELGWI CDIWISLDILLCTASILSLCAIS+DRYLAVTRPLTYSRRRRSKKLALTMIFFVWI+A AITCPPMFGW
Sbjct:  146 KWELGWILCDIWISLDILLCTASILSLCAISIDRYLAVTRPLTYSRRRRSKKLALTMIFFVWISASAITCPPMFGW 221          
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|930661988|gb|KPJ03809.1| (Octopamine receptor [Papilio xuthus])

HSP 1 Score: 160.999 bits (406), Expect = 1.418e-46
Identity = 73/76 (96.05%), Postives = 75/76 (98.68%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            KWELGWI CDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVW++AGAITCPPMFGW
Sbjct:  145 KWELGWILCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWVSAGAITCPPMFGW 220          
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|909572882|ref|XP_013142077.1| (PREDICTED: probable G-protein coupled receptor No18 [Papilio polytes])

HSP 1 Score: 160.614 bits (405), Expect = 1.519e-45
Identity = 74/76 (97.37%), Postives = 75/76 (98.68%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            KWELGWI CDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWI+AGAITCPPMFGW
Sbjct:  162 KWELGWILCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWISAGAITCPPMFGW 237          
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|910324780|ref|XP_013165484.1| (PREDICTED: 5-hydroxytryptamine receptor 2B-like [Papilio xuthus])

HSP 1 Score: 159.458 bits (402), Expect = 3.161e-45
Identity = 73/76 (96.05%), Postives = 75/76 (98.68%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            KWELGWI CDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVW++AGAITCPPMFGW
Sbjct:  145 KWELGWILCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWVSAGAITCPPMFGW 220          
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|768429561|ref|XP_011555966.1| (PREDICTED: probable G-protein coupled receptor No18 [Plutella xylostella])

HSP 1 Score: 158.303 bits (399), Expect = 7.776e-45
Identity = 75/76 (98.68%), Postives = 75/76 (98.68%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            KWELGWI CDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW
Sbjct:  139 KWELGWILCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 214          
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|913314473|ref|XP_013188063.1| (PREDICTED: octopamine receptor-like [Amyelois transitella])

HSP 1 Score: 157.147 bits (396), Expect = 2.104e-44
Identity = 75/76 (98.68%), Postives = 75/76 (98.68%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            KWELGWI CDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW
Sbjct:  138 KWELGWILCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 213          
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|283945472|ref|NP_001164649.1| (tyramine receptor [Bombyx mori] >gi|270288718|dbj|BAI52938.1| tyramine receptor [Bombyx mori])

HSP 1 Score: 156.762 bits (395), Expect = 2.636e-44
Identity = 74/76 (97.37%), Postives = 75/76 (98.68%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            +WELGWI CDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW
Sbjct:  130 EWELGWILCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 205          
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|943946892|ref|XP_014356598.1| (PREDICTED: probable G-protein coupled receptor No18 [Papilio machaon])

HSP 1 Score: 157.147 bits (396), Expect = 2.826e-44
Identity = 72/76 (94.74%), Postives = 74/76 (97.37%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            KWELGWI CDIWISLDILLCTASILSLCAIS+DRYLAVTRPLTYSRRRRSKKLALTMIFFVWI+A AITCPPMFGW
Sbjct:  146 KWELGWILCDIWISLDILLCTASILSLCAISIDRYLAVTRPLTYSRRRRSKKLALTMIFFVWISASAITCPPMFGW 221          
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|357604202|gb|EHJ64085.1| (tyramine receptor [Danaus plexippus])

HSP 1 Score: 154.066 bits (388), Expect = 2.857e-44
Identity = 74/76 (97.37%), Postives = 74/76 (97.37%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            KWELGWI CDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMI FVWIAAGAITCPPMFGW
Sbjct:   12 KWELGWILCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMILFVWIAAGAITCPPMFGW 87          
BLAST of OSCA025875-RA vs. genbank:protein
Match: gi|270288716|dbj|BAI52937.1| (tyramine receptor [Bombyx mori])

HSP 1 Score: 156.377 bits (394), Expect = 3.090e-44
Identity = 74/76 (97.37%), Postives = 75/76 (98.68%), Query Frame = 0
Query:    1 KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 76
            +WELGWI CDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW
Sbjct:  130 EWELGWILCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRSKKLALTMIFFVWIAAGAITCPPMFGW 205          
The following BLAST results are available for this feature:
BLAST of OSCA025875-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930681616|gb|KPJ21156.1|2.808e-4794.74Octopamine receptor [Papilio machaon][more]
gi|930661988|gb|KPJ03809.1|1.418e-4696.05Octopamine receptor [Papilio xuthus][more]
gi|909572882|ref|XP_013142077.1|1.519e-4597.37PREDICTED: probable G-protein coupled receptor No1... [more]
gi|910324780|ref|XP_013165484.1|3.161e-4596.05PREDICTED: 5-hydroxytryptamine receptor 2B-like [P... [more]
gi|768429561|ref|XP_011555966.1|7.776e-4598.68PREDICTED: probable G-protein coupled receptor No1... [more]
gi|913314473|ref|XP_013188063.1|2.104e-4498.68PREDICTED: octopamine receptor-like [Amyelois tran... [more]
gi|283945472|ref|NP_001164649.1|2.636e-4497.37tyramine receptor [Bombyx mori] >gi|270288718|dbj|... [more]
gi|943946892|ref|XP_014356598.1|2.826e-4494.74PREDICTED: probable G-protein coupled receptor No1... [more]
gi|357604202|gb|EHJ64085.1|2.857e-4497.37tyramine receptor [Danaus plexippus][more]
gi|270288716|dbj|BAI52937.1|3.090e-4497.37tyramine receptor [Bombyx mori][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007186 G-protein coupled receptor signaling pathway
biological_process GO:0007210 serotonin receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004930 G-protein coupled receptor activity
molecular_function GO:0004993 G-protein coupled serotonin receptor activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 53..74
score: 24.62
coord: 16..38
score: 41.66
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 1..76
e-value: 1.0E-25
score: 90.2
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 22..38
NoneNo IPR availableGENE3D1.20.1070.10coord: 1..76
e-value: 3.7E-28
score: 97.6
NoneNo IPR availablePANTHERPTHR24249HISTAMINE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 2..76
NoneNo IPR availablePANTHERPTHR24249:SF27IP13425Pcoord: 2..76
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 75..76
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 12..32
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..11
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 33..52
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 53..74
NoneNo IPR availableSUPERFAMILY81321Family A G protein-coupled receptor-likecoord: 2..76
NoneNo IPR availableTMHMMTMhelixcoord: 53..75
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 1..76
score: 18.486

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25438contignewscf_25438:1476..1706 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025875-RAOSCA025875-RAOstrinia scapulalismRNAnewscf_25438 1476..1706 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025875-PA ID=OSCA025875-PA|Name=OSCA025875-RA|organism=Ostrinia scapulalis|type=polypeptide|length=76bp
KWELGWIFCDIWISLDILLCTASILSLCAISVDRYLAVTRPLTYSRRRRS
KKLALTMIFFVWIAAGAITCPPMFGW
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004993G-protein coupled serotonin receptor activity
GO:0004930G-protein coupled receptor activity
Vocabulary: Biological Process
TermDefinition
GO:0007210serotonin receptor signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR017452GPCR_Rhodpsn_7TM
IPR000276GPCR_Rhodpsn