OSCA025876-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025876-RA
Unique NameOSCA025876-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length70
Homology
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 109.383 bits (272), Expect = 2.821e-26
Identity = 56/75 (74.67%), Postives = 62/75 (82.67%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            M YG+ET     GL+RRLKVTQRAMERAMLG S RD+IRNEEIRR+T VTDIA+RIA +KWQWA HIAR  DGRW
Sbjct:  855 MTYGTETWSLTMGLMRRLKVTQRAMERAMLGVSLRDQIRNEEIRRKTMVTDIAQRIATLKWQWAGHIARGTDGRW 929          
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|189181684|ref|NP_001121193.1| (phosphatidylinositol 3-kinase 60 [Bombyx mori] >gi|186898235|gb|ACC94001.1| phosphatidylinositol 3-kinase 60 [Bombyx mori])

HSP 1 Score: 105.916 bits (263), Expect = 4.288e-25
Identity = 53/75 (70.67%), Postives = 60/75 (80.00%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            M YG+ET     GL+R+LKVTQRAMERAMLG S  D+IRNEEIRR+T VTDIA+RI  +KWQW  HIARR DGRW
Sbjct:   75 MTYGTETWLLTMGLMRKLKVTQRAMERAMLGVSLGDQIRNEEIRRKTMVTDIAQRIVTLKWQWTGHIARRTDGRW 149          
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|357612130|gb|EHJ67822.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 98.9821 bits (245), Expect = 5.952e-25
Identity = 51/75 (68.00%), Postives = 60/75 (80.00%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            M YGSET     GL+ RL+V QRAME+AML  S RDR+RN+EIRRRT+VTDIA+RI+ +KWQ A HIARR DGRW
Sbjct:   34 MAYGSETWCFTKGLMNRLRVVQRAMEKAMLAVSLRDRVRNDEIRRRTRVTDIAKRISSLKWQCAGHIARRTDGRW 108          
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 105.145 bits (261), Expect = 7.655e-25
Identity = 55/75 (73.33%), Postives = 60/75 (80.00%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            M YG+ET     G IRRLKVTQRAMERAMLG S RDR+RN+ IR RTKVTDIARRI  +KW+WA HIARR DGRW
Sbjct:  636 MTYGTETWPLTAGNIRRLKVTQRAMERAMLGVSLRDRVRNDAIRSRTKVTDIARRIVNLKWRWAGHIARRTDGRW 710          
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|357603461|gb|EHJ63790.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 98.5969 bits (244), Expect = 2.341e-24
Identity = 52/75 (69.33%), Postives = 60/75 (80.00%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            M YGSE      GL++RL+V QRAMERAM+G S RDRIRN+EIRRR K TDIA+RI+ +KWQWA HIARR DGRW
Sbjct:   59 MSYGSEMWCFTKGLMKRLRVAQRAMERAMIGVSLRDRIRNDEIRRRMKGTDIAKRISSLKWQWAGHIARRTDGRW 133          
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 101.679 bits (252), Expect = 4.247e-24
Identity = 66/75 (88.00%), Postives = 67/75 (89.33%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            MVYGSET     GLIRRLKVTQRAMERAMLG S RDRIRNEEIRRRT+VTDIARRIAKIKWQWA HIARRADGRW
Sbjct:  229 MVYGSETWSLTMGLIRRLKVTQRAMERAMLGVSLRDRIRNEEIRRRTRVTDIARRIAKIKWQWAGHIARRADGRW 303          
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|298204341|gb|ADI61819.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 102.834 bits (255), Expect = 5.127e-24
Identity = 50/75 (66.67%), Postives = 58/75 (77.33%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            M YG+ET     GL+R+ KV QRAMER MLG S  DR+RNEEIR+RTKVTDIA +I+K+KWQWA H  RR DGRW
Sbjct:  855 MTYGAETWTLTVGLVRKFKVAQRAMERCMLGVSLMDRLRNEEIRQRTKVTDIALKISKLKWQWAGHTCRRTDGRW 929          
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 102.449 bits (254), Expect = 5.695e-24
Identity = 66/75 (88.00%), Postives = 67/75 (89.33%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            MVYGSET     GLIRRLKVTQRAMERAMLG S RDRIRNEEIRRRT+VTDIARRIAKIKWQWA HIARRADGRW
Sbjct:  363 MVYGSETWSLTMGLIRRLKVTQRAMERAMLGVSLRDRIRNEEIRRRTRVTDIARRIAKIKWQWAGHIARRADGRW 437          
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 102.064 bits (253), Expect = 7.917e-24
Identity = 66/75 (88.00%), Postives = 67/75 (89.33%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            MVYGSET     GLIRRLKVTQRAMERAMLG S RDRIRNEEIRRRT+VTDIARRIAKIKWQWA HIARRADGRW
Sbjct:  344 MVYGSETWSLTMGLIRRLKVTQRAMERAMLGVSLRDRIRNEEIRRRTRVTDIARRIAKIKWQWAGHIARRADGRW 418          
BLAST of OSCA025876-RA vs. genbank:protein
Match: gi|838097688|gb|KLV34200.1| (hypothetical protein AB894_15325, partial [Piscirickettsia salmonis])

HSP 1 Score: 101.679 bits (252), Expect = 1.594e-23
Identity = 50/75 (66.67%), Postives = 60/75 (80.00%), Query Frame = 0
Query:    1 MVYGSET-----GLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARRIAKIKWQWAWHIARRADGRW 70
            M YG+ET     GL+ RL+V QRAMERAMLG S RD+IRN EIR+RT+VTDIA +I ++KWQWA H+ARR DGRW
Sbjct:  688 MTYGTETWSLTAGLLERLRVAQRAMERAMLGVSLRDKIRNMEIRQRTRVTDIALKICRLKWQWAGHVARRTDGRW 762          
The following BLAST results are available for this feature:
BLAST of OSCA025876-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|298204337|gb|ADI61817.1|2.821e-2674.67endonuclease-reverse transcriptase [Bombyx mori][more]
gi|189181684|ref|NP_001121193.1|4.288e-2570.67phosphatidylinositol 3-kinase 60 [Bombyx mori] >gi... [more]
gi|357612130|gb|EHJ67822.1|5.952e-2568.00endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|909577882|ref|XP_013144778.1|7.655e-2573.33PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|357603461|gb|EHJ63790.1|2.341e-2469.33endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|134001247|gb|ABO45233.1|4.247e-2488.00reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|298204341|gb|ADI61819.1|5.127e-2466.67endonuclease-reverse transcriptase [Bombyx mori][more]
gi|134001323|gb|ABO45239.1|5.695e-2488.00reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|7.917e-2488.00reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|838097688|gb|KLV34200.1|1.594e-2366.67hypothetical protein AB894_15325, partial [Pisciri... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0043551 regulation of phosphatidylinositol 3-kinase activity
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
cellular_component GO:0005942 phosphatidylinositol 3-kinase complex
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0016301 kinase activity
molecular_function GO:0035014 phosphatidylinositol 3-kinase regulator activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_21131contignewscf_21131:2640..2849 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025876-RAOSCA025876-RAOstrinia scapulalismRNAnewscf_21131 2640..2849 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025876-PA ID=OSCA025876-PA|Name=OSCA025876-RA|organism=Ostrinia scapulalis|type=polypeptide|length=70bp
MVYGSETGLIRRLKVTQRAMERAMLGDSPRDRIRNEEIRRRTKVTDIARR
IAKIKWQWAWHIARRADGRW
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016301kinase activity
GO:0035014phosphatidylinositol 3-kinase regulator activity
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0043551regulation of phosphatidylinositol 3-kinase activity
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Cellular Component
TermDefinition
GO:0005942phosphatidylinositol 3-kinase complex