OSCA025877-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025877-RA
Unique NameOSCA025877-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length576
Homology
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|943960845|ref|XP_014362944.1| (PREDICTED: leucine-rich repeats and immunoglobulin-like domains protein 2 [Papilio machaon] >gi|930670885|gb|KPJ11688.1| Leucine-rich repeat neuronal protein 2 [Papilio machaon])

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 486/576 (84.38%), Postives = 542/576 (94.10%), Query Frame = 0
Query:    1 MGSRSVAKWRWWVVVVACAWGAAARTLCPARCACDDTLRAASCANAXLEIVPIQLNPEATHINLTHNAIDNLLYTFGFYTQLTILDISYNKIQDLGSKNFENNQEMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            MGS+SVAKWRWW+VV A   GAAARTLCPARC+CDD LRAASCANA LEIVPIQLNPEATHINLT N+I NLLYTF FYTQLT+LDISYNKIQDLGSKNFENN EMTHLN+SHNFLKRLD  TF+GLK LVDLDLS+N+I++IH Q+FK L+VLE+LDLS+NKLVSFE  TFEPL++LKILSLKNNSILDIPS+NL+++++LE+LDLSENLIQQVSK G+PYLKELK +DLN+NII+++DQLGF  LPSLRH DLSDNNMT+IPT ALSKLSNLSHLYLSGNFFQNVTALSFQSLFHL+HLHLSRL+EL+KIDS+AFVDNINLQKIWMNEN+KV EVPPRLFHGNPKLTHIYM+NNALETLEA+HFPIDRLQELEISGNP+VCNCS+LWLWKL RE E++ ++S NASTIL IDYE+V+C+APEHLK+++ + +PESEFGCSNGWVIVAVVV+TVSI+IS+VGG LYFMGPLKKCKGDKSKQVMTSVMLN DVSKL NGLGYSTRSREQENKR+VDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV
Sbjct:    1 MGSQSVAKWRWWLVVAAWWCGAAARTLCPARCSCDDALRAASCANAGLEIVPIQLNPEATHINLTQNSISNLLYTFPFYTQLTVLDISYNKIQDLGSKNFENNIEMTHLNLSHNFLKRLDVGTFVGLKRLVDLDLSNNQITDIHVQSFKDLAVLERLDLSSNKLVSFEVETFEPLSSLKILSLKNNSILDIPSSNLMYLINLEFLDLSENLIQQVSKPGVPYLKELKYIDLNNNIIESIDQLGFQNLPSLRHLDLSDNNMTSIPTFALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLRHLHLSRLFELEKIDSRAFVDNINLQKIWMNENIKVREVPPRLFHGNPKLTHIYMKNNALETLEAAHFPIDRLQELEISGNPFVCNCSLLWLWKLGRECEMNIKRSDNASTILKIDYEEVKCAAPEHLKDVLLVPIPESEFGCSNGWVIVAVVVMTVSIIISLVGGGLYFMGPLKKCKGDKSKQVMTSVMLNSDVSKLGNGLGYSTRSREQENKREVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576          
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|910346661|ref|XP_013177247.1| (PREDICTED: leucine-rich repeat-containing protein 4B-like [Papilio xuthus])

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 484/576 (84.03%), Postives = 542/576 (94.10%), Query Frame = 0
Query:    1 MGSRSVAKWRWWVVVVACAWGAAARTLCPARCACDDTLRAASCANAXLEIVPIQLNPEATHINLTHNAIDNLLYTFGFYTQLTILDISYNKIQDLGSKNFENNQEMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            MGS+SVAKWR W VV A   GAAARTLCPARC+CDD LRAASCANA LEIVPIQLNPEATHINLT N+I NLLYTF FYTQLT+LDIS+NKIQDLGSKNFENN EMTHLN+SHNFLK+LD  TF+GLK LVDLDLS+N+I++IH Q+FK L+VLE+LDLS+NKLVSFE  TFEPL++LKILSLKNNSILDIPS+NL++++HLE+LDLSENLIQQVSK G+PYLKELK++DLN+NII+++DQLGF  LPSLRH DLSDNNMT+IPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHL+HLHLSRL+EL+KIDS+AFVDNINLQKIWMNEN+KV EVPPRLFHGNPKLTHIYM+NNALETLEA+HFPIDRLQELEISGNP+VCNCS+LWLWKL RE E++ ++S NAS IL IDYE+V+C+AP+HLK+++ + +PESEFGCSNGWVIVAVVV+TVSI+IS+VGGVLYFMGPLKKCKGDKSKQVMTSVMLN DVSKL NGLGYSTRSREQENKR+VDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV
Sbjct:    1 MGSQSVAKWRLWFVVAAWWCGAAARTLCPARCSCDDALRAASCANASLEIVPIQLNPEATHINLTQNSISNLLYTFPFYTQLTVLDISHNKIQDLGSKNFENNIEMTHLNLSHNFLKKLDIGTFVGLKRLVDLDLSNNQITDIHVQSFKDLAVLERLDLSSNKLVSFEVETFEPLSSLKILSLKNNSILDIPSSNLIYLIHLEFLDLSENLIQQVSKQGVPYLKELKHIDLNNNIIESIDQLGFQNLPSLRHLDLSDNNMTSIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLRHLHLSRLFELEKIDSRAFVDNINLQKIWMNENIKVREVPPRLFHGNPKLTHIYMKNNALETLEAAHFPIDRLQELEISGNPFVCNCSLLWLWKLGRECEMNIKRSDNASNILKIDYEEVKCAAPDHLKDVLLVPIPESEFGCSNGWVIVAVVVMTVSIIISLVGGVLYFMGPLKKCKGDKSKQVMTSVMLNSDVSKLGNGLGYSTRSREQENKREVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576          
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|930655199|gb|KPI97530.1| (Leucine-rich repeat neuronal protein 2 [Papilio xuthus])

HSP 1 Score: 1006.9 bits (2602), Expect = 0.000e+0
Identity = 483/576 (83.85%), Postives = 541/576 (93.92%), Query Frame = 0
Query:    1 MGSRSVAKWRWWVVVVACAWGAAARTLCPARCACDDTLRAASCANAXLEIVPIQLNPEATHINLTHNAIDNLLYTFGFYTQLTILDISYNKIQDLGSKNFENNQEMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            MGS+SVAKWR W VV A   GAAARTLCPARC+CDD LRAASCANA LEIVPIQLNPEATHINLT N+I NLLYTF FYTQLT+LDIS+NKIQDLGSKNFENN EMTHLN+SHNFLK+LD  TF+GLK L+DLDLS+N+I++IH Q+FK L+VLE+LDLS+NKLVSFE  TFEPL++LKILSLKNNSILDIPS+NL++++HLE+LDLSENLIQQVSK G+PYLKELK++DLN+NII+ +DQLGF  LPSLRH DLSDNNMT+IPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHL+HLHLSRL+EL+KIDS+AFVDNINLQKIWMNEN+KV EVPPRLFHGNPKLTHIYM+NNALETLEA+HFPIDRLQELEISGNP+VCNCS+LWLWKL RE E++ ++S NAS IL IDYE+V+C+AP+HLK+++ + +PESEFGCSNGWVIVAVVV+TVSI+IS+VGGVLYFMGPLKKCKGDKSKQVMTSVMLN DVSKL NGLGYSTRSREQENKR+VDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV
Sbjct:    1 MGSQSVAKWRLWFVVAAWWCGAAARTLCPARCSCDDALRAASCANASLEIVPIQLNPEATHINLTQNSISNLLYTFPFYTQLTVLDISHNKIQDLGSKNFENNIEMTHLNLSHNFLKKLDIGTFVGLKRLIDLDLSNNQITDIHVQSFKDLAVLERLDLSSNKLVSFEVETFEPLSSLKILSLKNNSILDIPSSNLIYLIHLEFLDLSENLIQQVSKQGVPYLKELKHIDLNNNIIEGIDQLGFQNLPSLRHLDLSDNNMTSIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLRHLHLSRLFELEKIDSRAFVDNINLQKIWMNENIKVREVPPRLFHGNPKLTHIYMKNNALETLEAAHFPIDRLQELEISGNPFVCNCSLLWLWKLGRECEMNIKRSDNASNILKIDYEEVKCAAPDHLKDVLLVPIPESEFGCSNGWVIVAVVVMTVSIIISLVGGVLYFMGPLKKCKGDKSKQVMTSVMLNSDVSKLGNGLGYSTRSREQENKREVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576          
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|909560064|ref|XP_013135108.1| (PREDICTED: insulin-like growth factor-binding protein complex acid labile subunit [Papilio polytes])

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 485/576 (84.20%), Postives = 540/576 (93.75%), Query Frame = 0
Query:    1 MGSRSVAKWRWWVVVVACAWGAAARTLCPARCACDDTLRAASCANAXLEIVPIQLNPEATHINLTHNAIDNLLYTFGFYTQLTILDISYNKIQDLGSKNFENNQEMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            MGS+ VAKWRWW VV A   GAAARTLCPARC+CDD LRAASCANA LEIVPIQLNPEATHINLT N+I NLLYTF FYTQLT+LDIS+NKIQDLGSKNFENN EMTHLN+S NFLKRLD  TF+GLK LVDLDLS+N+I++IH Q+FK L+VLE+LDLS+NKLVSFE  TFEPL++LKILSLKNNSILDIPS+N ++++HLE+LDLSENLIQQVSK GIPYLKELK++DLN+NII++VDQLGF  LPSLRH DLSDNNMT+IPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHL+HLHLSRL+EL+KIDS+AFVDNINLQKIWMNEN+KV EVPPRLFHGNPKLTHIYM+NNALETLEA+HFPIDRLQELEISGNP+VCNCS+LWLWKL RE E++ ++S NASTIL IDYE+V+C+APEHLK+++ + +PESEFGCSNGWVIVAVVV+TVSI+IS+VGG LYFMGPLKKCKGDKSKQVMTSVMLN DVSKL NGLGYSTRSREQ+NKR+VDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV
Sbjct:    1 MGSQGVAKWRWWFVVAAWWCGAAARTLCPARCSCDDALRAASCANAGLEIVPIQLNPEATHINLTQNSISNLLYTFPFYTQLTVLDISHNKIQDLGSKNFENNIEMTHLNLSDNFLKRLDVGTFVGLKRLVDLDLSNNQITDIHVQSFKDLAVLERLDLSSNKLVSFEVETFEPLSSLKILSLKNNSILDIPSSNFVYLIHLEFLDLSENLIQQVSKQGIPYLKELKHVDLNNNIIESVDQLGFQNLPSLRHLDLSDNNMTSIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLRHLHLSRLFELEKIDSRAFVDNINLQKIWMNENIKVREVPPRLFHGNPKLTHIYMKNNALETLEAAHFPIDRLQELEISGNPFVCNCSLLWLWKLGRECEMNIKRSDNASTILKIDYEEVKCAAPEHLKDVLLVPIPESEFGCSNGWVIVAVVVMTVSIIISLVGGGLYFMGPLKKCKGDKSKQVMTSVMLNSDVSKLGNGLGYSTRSREQDNKREVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576          
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|913326521|ref|XP_013194674.1| (PREDICTED: leucine-rich repeat neuronal protein 2-like [Amyelois transitella])

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 500/576 (86.81%), Postives = 539/576 (93.58%), Query Frame = 0
Query:    1 MGSRSVAKWRWWVVVVACAWGAAARTLCPARCACDDTLRAASCANAXLEIVPIQLNPEATHINLTHNAIDNLLYTFGFYTQLTILDISYNKIQDLGSKNFENNQEMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            MGSR VAKWRWWVVVVA +WGAAARTLCPARCACDD LRAASCANA LEIVPIQLNPEATHINLTHN I+NLLYTF FYTQLT+LD+SYNKIQDL SKNFENN EMTHLN+SHN LK LDKDTFIGLK LVDLDLS+N ISN+HAQTFK LSVLEKLDLSNNKLVSF+ +TFEPL+ LKILSL+NNSILDIPSANL FVVHLE+LDLSENLIQ+V KHG+PYLKELK+ DLNSNII+ +DQLGFH LPSLRH DLSDNNMT+IPTSA+SKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLY+L+KIDS+AFVDNINLQKIWMNENVKV EVPPRLFHGNPKLTHIYMRNNAL TLEASHFPIDRLQELEISGNP++CNCS+LWLWKL RESEI+ +++ N +  L IDYEDV+C+ P HL  ++F+Q+PESEFGCS+GWVIVAVVVLTVSI+ISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKL NGLGYSTR REQENKR+VDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIP HRTPEKPHIVYV
Sbjct:    1 MGSRGVAKWRWWVVVVAWSWGAAARTLCPARCACDDALRAASCANAGLEIVPIQLNPEATHINLTHNIINNLLYTFAFYTQLTVLDMSYNKIQDLDSKNFENNMEMTHLNLSHNLLKHLDKDTFIGLKKLVDLDLSNNVISNVHAQTFKDLSVLEKLDLSNNKLVSFQPDTFEPLSTLKILSLRNNSILDIPSANLFFVVHLEFLDLSENLIQRVPKHGMPYLKELKHFDLNSNIIEEIDQLGFHNLPSLRHLDLSDNNMTSIPTSAISKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYDLEKIDSRAFVDNINLQKIWMNENVKVGEVPPRLFHGNPKLTHIYMRNNALGTLEASHFPIDRLQELEISGNPFICNCSLLWLWKLGRESEINSKRARNDTLTLKIDYEDVKCAGPAHLNGVLFVQIPESEFGCSSGWVIVAVVVLTVSIIISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLGNGLGYSTRGREQENKREVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPPHRTPEKPHIVYV 576          
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|827560604|ref|XP_004932339.2| (PREDICTED: SLIT and NTRK-like protein 4 [Bombyx mori])

HSP 1 Score: 987.252 bits (2551), Expect = 0.000e+0
Identity = 471/577 (81.63%), Postives = 525/577 (90.99%), Query Frame = 0
Query:    1 MGSRSVAKWRWWVVVVACAW-GAAARTLCPARCACDDTLRAASCANAXLEIVPIQLNPEATHINLTHNAIDNLLYTFGFYTQLTILDISYNKIQDLGSKNFENNQEMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            MGSR V KWR W+V+ A  W  AAA+TLCP RC CDD LRAASCANA LEIVPIQLNPEAT +NLTHNAIDNLLY F  YTQLT+LDISYNKI DLGS+NFE+N EM HLN+S+NFLKRLDKD F+GL  LVDL+LS+NEISNIH QTF+ LS LE+LD SNN+LV+FE  TFEPL++LKILSL+NNSILDIPSANL FV+HLEYLDLSENLIQQVS+HG+P+LKELK+LDLN+NII++VDQLGFH LPSLRH DLSDNNMT IPTSALSKLSNLSHLYLSGNFFQNV++LSFQSLF LKHLHLSRLY L++IDS+AFVDNINLQKIWMN+NVKV EVPPRLFHGNPKLT+IYM+NNALETLEASHFPIDRLQELEISGNP+ CNCS+LWLWKL ++SE + +KSGN+S  L IDYEDV+CS P  LK M+F+Q+PESEFGCS+GWVI AVVVLTVSI+ISVV  VLYFMGPLKKCKGDKSKQ+MTSVM+NGDVSKL NGLGYS+R REQ+NKRDVDRYLMIGSSVTNNFHSLNPPW+SVDKNPYYQE+SEEHIYQQFAYETIP HRTPEKPHIVYV
Sbjct:    1 MGSR-VVKWRCWMVLFAWTWSAAAAKTLCPVRCMCDDALRAASCANANLEIVPIQLNPEATLMNLTHNAIDNLLYAFNLYTQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRLDKDAFVGLNSLVDLNLSNNEISNIHVQTFRDLSALERLDFSNNRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNIIESVDQLGFHSLPSLRHLDLSDNNMTLIPTSALSKLSNLSHLYLSGNFFQNVSSLSFQSLFLLKHLHLSRLYVLERIDSRAFVDNINLQKIWMNDNVKVREVPPRLFHGNPKLTNIYMKNNALETLEASHFPIDRLQELEISGNPFACNCSLLWLWKLGKDSETTTKKSGNSSEFLKIDYEDVKCSGPLQLKGMLFVQIPESEFGCSSGWVIDAVVVLTVSIIISVVCAVLYFMGPLKKCKGDKSKQIMTSVMMNGDVSKLGNGLGYSSRGREQDNKRDVDRYLMIGSSVTNNFHSLNPPWNSVDKNPYYQEESEEHIYQQFAYETIPPHRTPEKPHIVYV 576          
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|357610455|gb|EHJ66988.1| (putative tartan [Danaus plexippus])

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 391/471 (83.01%), Postives = 442/471 (93.84%), Query Frame = 0
Query:  106 MTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            MTHLNVSHN LKRLDKDTF+GLK L DLDLSDN+IS+IH QTFK LSV+E LDLSNN LV+FEA+TFEPL++L+ LSL+NNSIL+IPSANL+F+VHLE+LDLSENLIQ V KHGIPYLKELK+L+LNSNII+++DQLG H LPSLRH DLSDNN+TTIPTSALSKL+NLSHLYLSGNFFQN+++LSFQSLFHLKHLHLSRL+EL+KID++AFVDNINLQKIWMNEN+ V EVPPR+FHGNPKLTHIY++NNALETLEASHFPID LQELEISGNP+VCNCSILWLW L R  EI  +KS N+STIL IDYE+V+C+AP HL  ++F+Q+PESEFGCS+GWV+VA+VVLT SI+ISVVGGVLYFMGPLKKCKGDKSKQVM +VMLNGDVSKLSNGLGYSTR+REQENKR+VDRYLMIGS+VTNNFHSLNPPWHSVDK+PYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV
Sbjct:    1 MTHLNVSHNALKRLDKDTFVGLKRLRDLDLSDNDISSIHPQTFKDLSVIETLDLSNNMLVTFEADTFEPLSSLRTLSLRNNSILEIPSANLIFLVHLEFLDLSENLIQVVEKHGIPYLKELKHLNLNSNIIESIDQLGMHNLPSLRHLDLSDNNLTTIPTSALSKLTNLSHLYLSGNFFQNISSLSFQSLFHLKHLHLSRLHELEKIDARAFVDNINLQKIWMNENLNVREVPPRVFHGNPKLTHIYIKNNALETLEASHFPIDTLQELEISGNPFVCNCSILWLWSLGRACEIPSKKSDNSSTILKIDYEEVKCAAPAHLSGILFVQIPESEFGCSSGWVVVAIVVLTGSIIISVVGGVLYFMGPLKKCKGDKSKQVMNTVMLNGDVSKLSNGLGYSTRTREQENKREVDRYLMIGSTVTNNFHSLNPPWHSVDKSPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 471          

HSP 2 Score: 71.2478 bits (173), Expect = 1.685e-9
Identity = 80/308 (25.97%), Postives = 141/308 (45.78%), Query Frame = 0
Query:   60 THINLTHNAIDNLLY-TFGFYTQLTILDISYNKIQDLGSKNFENNQEMTHLNVSHNFLKRLDKDTF------------------------IGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNS-NIIDNVDQLGFHRLPSLRHXDLSDN-NMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPR 340
            TH+N++HNA+  L   TF    +L  LD+S N I  +  + F++   +  L++S+N L   + DTF                        I L  L  LDLS+N I  +       L  L+ L+L++N + S +      L +L+ L L +N++  IP++ L  + +L +L LS N  Q +S      L  LK+L L+  + ++ +D   F    +L+   +++N N+  +P         L+H+Y+  N  + + A          H  +  L EL+ I    FV N ++  +W+    +  E+P +
Sbjct:    2 THLNVSHNALKRLDKDTFVGLKRLRDLDLSDNDISSIHPQTFKDLSVIETLDLSNNMLVTFEADTFEPLSSLRTLSLRNNSILEIPSANLIFLVHLEFLDLSENLIQVVEKHGIPYLKELKHLNLNSNIIESIDQLGMHNLPSLRHLDLSDNNLTTIPTSALSKLTNLSHLYLSGNFFQNISSLSFQSLFHLKHLHLSRLHELEKIDARAFVDNINLQKIWMNENLNVREVPPRVFHGNPKLTHIYIKNNALETLEA---------SHFPIDTLQELE-ISGNPFVCNCSI--LWLWSLGRACEIPSK 297          
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|768428082|ref|XP_011555163.1| (PREDICTED: leucine-rich repeat neuronal protein 2-like [Plutella xylostella])

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 377/472 (79.87%), Postives = 428/472 (90.68%), Query Frame = 0
Query:  105 EMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            EMT LNVSHN L+RL+KDTF+GLK L+DL+LSDNEISNIH QTFK LSVLE+LDLSNNKLVSF+A TFEPL+ALKILSLKNN+ILDIPSANL +V+ LEYLD+SENL+QQV K+G+ YLK L++LDLNSNII ++D L FH LP LRH DLSDNNMT +PTS+LSKLSNLSHLYLSGNFFQNVTALSFQSLFHLK+LHLSRLYEL++IDS+AFVDNINLQKIWMNENVKV E+PPRLFHGNPKLTHIYM+NNAL+TLEA+HFPID+LQEL+ISGNP+VCNCS+LWLWKL RE E ++ K  N  T L IDYE V+C+APE L+ ++F+Q PESEFGCS+GWV+VAVVVLTVSIVISVVGGVLYF+GPLKKCKGDKSKQVMTSVML  DVSKL NGL YSTR REQE KR+VDRYLMIGS+V+NNFHSL+PPWH VDK+PY QE+ EEH+YQQFAYETIP HR PEKPHIVYV
Sbjct:    2 EMTQLNVSHNALRRLEKDTFLGLKRLLDLNLSDNEISNIHTQTFKDLSVLERLDLSNNKLVSFDAETFEPLSALKILSLKNNAILDIPSANLFYVIQLEYLDMSENLVQQVPKNGLQYLKSLRHLDLNSNIISSIDSLAFHNLPLLRHLDLSDNNMTAVPTSSLSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKNLHLSRLYELERIDSRAFVDNINLQKIWMNENVKVREIPPRLFHGNPKLTHIYMKNNALDTLEAAHFPIDKLQELQISGNPFVCNCSLLWLWKLGRECEANNNKVENG-TALKIDYELVKCAAPERLRNVMFVQAPESEFGCSSGWVVVAVVVLTVSIVISVVGGVLYFLGPLKKCKGDKSKQVMTSVMLKSDVSKLGNGLVYSTR-REQEAKREVDRYLMIGSTVSNNFHSLSPPWH-VDKSPYSQEEPEEHVYQQFAYETIPAHRAPEKPHIVYV 470          
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|914574853|gb|KOB77071.1| (putative tartan [Operophtera brumata])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 353/571 (61.82%), Postives = 395/571 (69.18%), Query Frame = 0
Query:    6 VAKWRWWVVVVACAWGAAARTLCPARCACDDTLRAASCANAXLEIVPIQLNPEATHINLTHNAIDNLLYTFGFYTQLTILDISYNKIQDLGSKNFENNQEMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            VAKWRWW+VV A AWGA ARTLCPA+CACDD LRAASCANA LEIVPIQLNPEAT+INLTHN+I +LLYTFGFYTQLT+LDISYN+I DL  KNFENN EMTHL                        +L+ N +  +   TF  L  L  LDLS+N+L      TF+ LT+L                        E LDLS N +    +     L  LK L L +N I ++  L F  L  L   D+S N +  IP   +  L  L HL  + N  +N+  L F +L  L+HL L                                 +PPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQ LEISGNP+VCNCS++WLWKL  ESEI++R+S N STIL IDYEDV+C+AP HLK ++FIQ PESEFGCSNGWVIVA+VVLTVSIVISVVGGVLYFMGPLKKCKGDKSK VMTSVMLNGDVSKL NGLGYSTRSREQENKR+VDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDS+EHIYQQFAYETIP HRTPEKPHIVYV
Sbjct:    5 VAKWRWWLVVAAWAWGATARTLCPAKCACDDALRAASCANASLEIVPIQLNPEATYINLTHNSITDLLYTFGFYTQLTVLDISYNRIVDLFDKNFENNIEMTHL------------------------NLTSNFLKRLDKDTFVGLKGLIDLDLSSNELFDIHQQTFKDLTSL------------------------ERLDLSSNKLVGFKRDTFEPLTSLKLLSLRNNTILDLPTLNFAYLVHLEFLDMSLNLVQEIPKHGIPYLKELKHLDFNTNVIENIDQLGFHNLPSLRHLDL---------------------------------IPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQVLEISGNPFVCNCSLIWLWKLGMESEINNRRSKNTSTILKIDYEDVKCTAPMHLKGVLFIQCPESEFGCSNGWVIVAIVVLTVSIVISVVGGVLYFMGPLKKCKGDKSKTVMTSVMLNGDVSKLGNGLGYSTRSREQENKREVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSDEHIYQQFAYETIPAHRTPEKPHIVYV 494          
BLAST of OSCA025877-RA vs. genbank:protein
Match: gi|270016564|gb|EFA13010.1| (Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 [Tribolium castaneum])

HSP 1 Score: 426.402 bits (1095), Expect = 8.317e-140
Identity = 228/583 (39.11%), Postives = 354/583 (60.72%), Query Frame = 0
Query:   11 WW-----VVVVACAWGAAARTLCPARCACDDTLRAASCANAXLEIVPIQLNPEATHINLTHNAIDNLLYTFGFYTQLTILDISYNKIQDLGSKNFENNQEMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKALSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVVHLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSLRHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKHLHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTHIYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARE----------SEISHRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAVVVLTVSIVISVVGGVLYFMGPLKK-CKGDKSKQVMTSVMLNGDVSKLSNGLGYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQE-DSEEHIYQQFAYETIPHHRTPEKPHIVYV 576
            WW     ++V+A    A+   +CPARC C+D    ASC +A LE+VPIQLNPE  HI+L+ N I ++ +TF FY  L  LD+S NKI++LGS NF+    +  LN+S N ++++ KD+F GL+ +  LDLS N++  + ++TF+ L  L+ L LS N+LV  E   F+    L+ L L +N  L++P+  L   ++L ++ L+ NLI+ + ++ +P L EL+ L L  N+I+ + Q     L +L H DLSDNN T IPT +L+KLSN++ L LSGNF   V  ++F+ LFHL+ L L R   L++ID++AFVDNINL+++W+++N+ V  +P RLFHGNP++TH+ +RNN L  +E +HFP+D+L+ L+++GNP  CNCS+ WLW L +E          ++ S  + G +   L +D ED+RC+ PE L +++     ES+  CS  W+      LT   ++ +VGG+LY+ GP+K+ C  +K    + S   N  V   SNG     RS   EN R  D+ ++    + +++ +L P W     +PY  +     +IY+        +++T  +PHIVYV
Sbjct:   10 WWQTLPTMLVLATIGSASDGAICPARCHCNDDTLTASCGSAALEVVPIQLNPEVRHIDLSDNKITHVSFTFRFYNFLVTLDLSSNKIKNLGSSNFDMQHNLKQLNLSRNDIEKISKDSFKGLRAVTSLDLSHNKLEELKSETFRELHSLQVLKLSQNRLVYLEEGIFKSAKHLQELLLDHNLFLELPTGALTDTLNLRFVSLASNLIKSIKENQMPPLPELRTLLLQKNLINEIHQSSLSGLLALDHLDLSDNNFTVIPTPSLTKLSNITKLKLSGNFISTVPPVAFKGLFHLRFLRLDRQEILERIDTRAFVDNINLERVWLDDNIAVDRLPTRLFHGNPRVTHLSVRNNRLTNIEVTHFPLDQLRVLKLAGNPLECNCSLSWLWHLIQEQKSKRLFDLGNDTSEEEEGVSPGELVVDLEDIRCAGPEPLSDVLLADATESQVDCSVSWIAAVSATLTALFIVVIVGGLLYW-GPIKRACAKEKELAGVESRCRNKSVGACSNG-----RSEPFENIR-TDKCMIAPPLIHHDYRTL-PSW-----DPYSADCAGNMNIYEHLDL----NNKT--RPHIVYV 573          
The following BLAST results are available for this feature:
BLAST of OSCA025877-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|943960845|ref|XP_014362944.1|0.000e+084.38PREDICTED: leucine-rich repeats and immunoglobulin... [more]
gi|910346661|ref|XP_013177247.1|0.000e+084.03PREDICTED: leucine-rich repeat-containing protein ... [more]
gi|930655199|gb|KPI97530.1|0.000e+083.85Leucine-rich repeat neuronal protein 2 [Papilio xu... [more]
gi|909560064|ref|XP_013135108.1|0.000e+084.20PREDICTED: insulin-like growth factor-binding prot... [more]
gi|913326521|ref|XP_013194674.1|0.000e+086.81PREDICTED: leucine-rich repeat neuronal protein 2-... [more]
gi|827560604|ref|XP_004932339.2|0.000e+081.63PREDICTED: SLIT and NTRK-like protein 4 [Bombyx mo... [more]
gi|357610455|gb|EHJ66988.1|1.685e-983.01putative tartan [Danaus plexippus][more]
gi|768428082|ref|XP_011555163.1|0.000e+079.87PREDICTED: leucine-rich repeat neuronal protein 2-... [more]
gi|914574853|gb|KOB77071.1|0.000e+061.82putative tartan [Operophtera brumata][more]
gi|270016564|gb|EFA13010.1|8.317e-14039.11Leucine-rich repeat and immunoglobulin-like domain... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00019LEURICHRPTcoord: 151..164
score: 55.87
coord: 130..143
score: 44.85
NoneNo IPR availableSMARTSM00365LRR_SD22coord: 127..145
e-value: 18.0
score: 13.4
coord: 151..177
e-value: 170.0
score: 5.6
coord: 271..292
e-value: 290.0
score: 3.6
coord: 223..241
e-value: 27.0
score: 12.0
coord: 199..219
e-value: 490.0
score: 1.7
coord: 79..105
e-value: 61.0
score: 9.2
NoneNo IPR availableGENE3D3.80.10.10coord: 208..441
e-value: 1.3E-39
score: 135.0
coord: 28..207
e-value: 3.8E-40
score: 136.8
NoneNo IPR availablePFAMPF13516LRR_6coord: 80..100
e-value: 0.019
score: 14.8
NoneNo IPR availablePANTHERPTHR24365TOLL-LIKE RECEPTORcoord: 26..462
NoneNo IPR availablePANTHERPTHR24365:SF238FISH-LIPScoord: 26..462
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..24
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 470..576
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 445..469
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 20..24
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..10
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 11..19
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 25..444
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.892
NoneNo IPR availableSIGNALP_GRAM_NEGATIVESignalP-noTMSignalP-noTMcoord: 1..24
score: 0.586
NoneNo IPR availableSUPERFAMILY52058L domain-likecoord: 41..398
NoneNo IPR availableTMHMMTMhelixcoord: 445..467
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082LRRCTcoord: 379..442
e-value: 0.0029
score: 26.8
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_TYPcoord: 79..102
e-value: 140.0
score: 3.8
coord: 104..126
e-value: 130.0
score: 4.1
coord: 223..246
e-value: 130.0
score: 4.2
coord: 271..294
e-value: 3.7
score: 16.5
coord: 151..174
e-value: 0.04
score: 23.1
coord: 247..270
e-value: 0.65
score: 19.0
coord: 175..197
e-value: 81.0
score: 5.8
coord: 127..150
e-value: 0.18
score: 20.9
coord: 199..222
e-value: 95.0
score: 5.3
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 129..188
e-value: 6.2E-13
score: 48.1
coord: 248..304
e-value: 4.1E-10
score: 39.1
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 347..368
score: 5.071
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 273..294
score: 7.15
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 129..150
score: 6.888
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 249..270
score: 7.173
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 153..174
score: 7.381
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 105..126
score: 5.433
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 177..198
score: 7.204
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 201..224
score: 6.503
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 225..246
score: 7.173
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 81..102
score: 7.396

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_5161contignewscf_5161:22294..24024 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025877-RAOSCA025877-RAOstrinia scapulalismRNAnewscf_5161 22294..24024 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025877-PA ID=OSCA025877-PA|Name=OSCA025877-RA|organism=Ostrinia scapulalis|type=polypeptide|length=576bp
MGSRSVAKWRWWVVVVACAWGAAARTLCPARCACDDTLRAASCANAXLEI
VPIQLNPEATHINLTHNAIDNLLYTFGFYTQLTILDISYNKIQDLGSKNF
ENNQEMTHLNVSHNFLKRLDKDTFIGLKGLVDLDLSDNEISNIHAQTFKA
LSVLEKLDLSNNKLVSFEANTFEPLTALKILSLKNNSILDIPSANLLFVV
HLEYLDLSENLIQQVSKHGIPYLKELKNLDLNSNIIDNVDQLGFHRLPSL
RHXDLSDNNMTTIPTSALSKLSNLSHLYLSGNFFQNVTALSFQSLFHLKH
LHLSRLYELDKIDSKAFVDNINLQKIWMNENVKVSEVPPRLFHGNPKLTH
IYMRNNALETLEASHFPIDRLQELEISGNPYVCNCSILWLWKLARESEIS
HRKSGNASTILXIDYEDVRCSAPEHLKEMIFIQVPESEFGCSNGWVIVAV
VVLTVSIVISVVGGVLYFMGPLKKCKGDKSKQVMTSVMLNGDVSKLSNGL
GYSTRSREQENKRDVDRYLMIGSSVTNNFHSLNPPWHSVDKNPYYQEDSE
EHIYQQFAYETIPHHRTPEKPHIVYV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR001611Leu-rich_rpt
IPR003591Leu-rich_rpt_typical-subtyp
IPR000483Cys-rich_flank_reg_C