OSCA025878-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025878-RA
Unique NameOSCA025878-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length45
Homology
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 75.8702 bits (185), Expect = 6.293e-15
Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG 45
            TDDLVKVAG  WMQAAQDRSLWKSLGEAFVQQWTSFG
Sbjct:  461 TDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 497          
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 75.485 bits (184), Expect = 6.950e-15
Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG 45
            TDDLVKVAG  WMQAAQDRSLWKSLGEAFVQQWTSFG
Sbjct:  442 TDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 478          
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 75.0998 bits (183), Expect = 7.403e-15
Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG 45
            TDDLVKVAG  WMQAAQDRSLWKSLGEAFVQQWTSFG
Sbjct:  327 TDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 363          
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|930659181|gb|KPJ01280.1| (hypothetical protein RR46_01415 [Papilio xuthus])

HSP 1 Score: 68.1662 bits (165), Expect = 1.339e-12
Identity = 28/35 (80.00%), Postives = 33/35 (94.29%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTS 43
            TDDLVKVAG  WM+AAQDR+LW+S+GEA+VQQWTS
Sbjct:   59 TDDLVKVAGVHWMRAAQDRALWQSMGEAYVQQWTS 93          
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 68.1662 bits (165), Expect = 2.793e-12
Identity = 28/37 (75.68%), Postives = 35/37 (94.59%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG 45
            TDDLVKVAG  WM+AAQDR+LW+S+GEA+VQQWT++G
Sbjct:  734 TDDLVKVAGAHWMRAAQDRALWQSMGEAYVQQWTTYG 770          
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 62.003 bits (149), Expect = 8.683e-12
Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG 45
            TDDLVKVAG +WM+ AQDRS W+SLGEA+VQQW S G
Sbjct:   29 TDDLVKVAGASWMRVAQDRSSWRSLGEAYVQQWASHG 65          
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|930654552|gb|KPI96886.1| (hypothetical protein RR46_05011 [Papilio xuthus])

HSP 1 Score: 60.4622 bits (145), Expect = 3.493e-11
Identity = 28/37 (75.68%), Postives = 33/37 (89.19%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG 45
            TDDLVKVAG  WM AAQDR+LW+S+G+A+VQQWTS G
Sbjct:   33 TDDLVKVAGLHWMWAAQDRALWQSMGQAYVQQWTSLG 69          
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|930654247|gb|KPI96582.1| (hypothetical protein RR46_12612 [Papilio xuthus])

HSP 1 Score: 60.077 bits (144), Expect = 5.192e-11
Identity = 27/37 (72.97%), Postives = 31/37 (83.78%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG 45
            TDDLVKVAG +WM+ AQDRS W+SLGEA+ QQW S G
Sbjct:   29 TDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASHG 65          
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|930681500|gb|KPJ21040.1| (hypothetical protein RR48_00071 [Papilio machaon])

HSP 1 Score: 60.077 bits (144), Expect = 6.310e-11
Identity = 29/37 (78.38%), Postives = 32/37 (86.49%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG 45
            TDDLVKVAG  WM AAQDRSLW+S+GEA+VQQWT  G
Sbjct:   37 TDDLVKVAGVHWMLAAQDRSLWQSMGEAYVQQWTISG 73          
BLAST of OSCA025878-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 62.003 bits (149), Expect = 7.108e-11
Identity = 27/37 (72.97%), Postives = 32/37 (86.49%), Query Frame = 0
Query:    9 TDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG 45
            TDD+VK AG  WM+AA DR+ WKSLGEA+VQQWTS+G
Sbjct:  124 TDDIVKSAGKHWMRAASDRTRWKSLGEAYVQQWTSYG 160          
The following BLAST results are available for this feature:
BLAST of OSCA025878-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001323|gb|ABO45239.1|6.293e-1594.59reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|6.950e-1594.59reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001247|gb|ABO45233.1|7.403e-1594.59reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|930659181|gb|KPJ01280.1|1.339e-1280.00hypothetical protein RR46_01415 [Papilio xuthus][more]
gi|909577882|ref|XP_013144778.1|2.793e-1275.68PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|930681186|gb|KPJ20726.1|8.683e-1275.68hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|930654552|gb|KPI96886.1|3.493e-1175.68hypothetical protein RR46_05011 [Papilio xuthus][more]
gi|930654247|gb|KPI96582.1|5.192e-1172.97hypothetical protein RR46_12612 [Papilio xuthus][more]
gi|930681500|gb|KPJ21040.1|6.310e-1178.38hypothetical protein RR48_00071 [Papilio machaon][more]
gi|825740785|ref|WP_047149388.1|7.108e-1172.97hypothetical protein, partial [Escherichia coli][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
cellular_component GO:0005634 nucleus
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0003964 RNA-directed DNA polymerase activity
molecular_function GO:0008270 zinc ion binding
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_44745contignewscf_44745:822..959 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025878-RAOSCA025878-RAOstrinia scapulalismRNAnewscf_44745 822..959 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025878-PA ID=OSCA025878-PA|Name=OSCA025878-RA|organism=Ostrinia scapulalis|type=polypeptide|length=45bp
ALLLENDRTDDLVKVAGGAWMQAAQDRSLWKSLGEAFVQQWTSFG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis