OSCA025879-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025879-RA
Unique NameOSCA025879-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length50
Homology
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 81.6481 bits (200), Expect = 4.232e-17
Identity = 40/45 (88.89%), Postives = 41/45 (91.11%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFG 45
            V RP TR TDDLVKVAG TWM+AAQDRSLWKSLGEAFVQQWTSFG
Sbjct:  319 VGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 363          
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 82.0333 bits (201), Expect = 4.247e-17
Identity = 40/45 (88.89%), Postives = 41/45 (91.11%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFG 45
            V RP TR TDDLVKVAG TWM+AAQDRSLWKSLGEAFVQQWTSFG
Sbjct:  453 VGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 497          
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 81.6481 bits (200), Expect = 5.426e-17
Identity = 40/45 (88.89%), Postives = 41/45 (91.11%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFG 45
            V RP TR TDDLVKVAG TWM+AAQDRSLWKSLGEAFVQQWTSFG
Sbjct:  434 VGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 478          
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|930659181|gb|KPJ01280.1| (hypothetical protein RR46_01415 [Papilio xuthus])

HSP 1 Score: 74.7146 bits (182), Expect = 6.645e-15
Identity = 32/43 (74.42%), Postives = 37/43 (86.05%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTS 43
            V +P  R TDDLVKVAG  WMRAAQDR+LW+S+GEA+VQQWTS
Sbjct:   51 VGKPPARWTDDLVKVAGVHWMRAAQDRALWQSMGEAYVQQWTS 93          
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 68.5514 bits (166), Expect = 2.516e-14
Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFG 45
            V RP  R TDDLVKVAG +WMR AQDRS W+SLGEA+VQQW S G
Sbjct:   21 VGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYVQQWASHG 65          
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 73.1738 bits (178), Expect = 6.911e-14
Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFG 45
            V RP  R TDDLVKVAG  WMRAAQDR+LW+S+GEA+VQQWT++G
Sbjct:  726 VGRPPARWTDDLVKVAGAHWMRAAQDRALWQSMGEAYVQQWTTYG 770          
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|930654247|gb|KPI96582.1| (hypothetical protein RR46_12612 [Papilio xuthus])

HSP 1 Score: 67.3958 bits (163), Expect = 8.602e-14
Identity = 32/45 (71.11%), Postives = 35/45 (77.78%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFG 45
            V RP  R TDDLVKVAG +WMR AQDRS W+SLGEA+ QQW S G
Sbjct:   21 VGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASHG 65          
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 69.707 bits (169), Expect = 9.860e-14
Identity = 32/45 (71.11%), Postives = 37/45 (82.22%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFG 45
            V RP  R TDD+VK AG+ WMRAA DR+ WKSLGEA+VQQWTS+G
Sbjct:  116 VGRPPARWTDDIVKSAGKHWMRAASDRTRWKSLGEAYVQQWTSYG 160          
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|930648975|gb|KPI91323.1| (hypothetical protein RR46_14827 [Papilio xuthus])

HSP 1 Score: 67.0106 bits (162), Expect = 1.875e-13
Identity = 32/45 (71.11%), Postives = 35/45 (77.78%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFG 45
            V RP  R TDDLVKVAG +WMR AQDRS W+SLGEA+ QQW S G
Sbjct:   38 VGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASHG 82          
BLAST of OSCA025879-RA vs. genbank:protein
Match: gi|930681500|gb|KPJ21040.1| (hypothetical protein RR48_00071 [Papilio machaon])

HSP 1 Score: 66.6254 bits (161), Expect = 2.341e-13
Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = 0
Query:    1 VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFG 45
            V RP  R TDDLVKVAG  WM AAQDRSLW+S+GEA+VQQWT  G
Sbjct:   29 VGRPPARWTDDLVKVAGVHWMLAAQDRSLWQSMGEAYVQQWTISG 73          
The following BLAST results are available for this feature:
BLAST of OSCA025879-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001247|gb|ABO45233.1|4.232e-1788.89reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|4.247e-1788.89reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|5.426e-1788.89reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|930659181|gb|KPJ01280.1|6.645e-1574.42hypothetical protein RR46_01415 [Papilio xuthus][more]
gi|930681186|gb|KPJ20726.1|2.516e-1473.33hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|909577882|ref|XP_013144778.1|6.911e-1473.33PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|930654247|gb|KPI96582.1|8.602e-1471.11hypothetical protein RR46_12612 [Papilio xuthus][more]
gi|825740785|ref|WP_047149388.1|9.860e-1471.11hypothetical protein, partial [Escherichia coli][more]
gi|930648975|gb|KPI91323.1|1.875e-1371.11hypothetical protein RR46_14827 [Papilio xuthus][more]
gi|930681500|gb|KPJ21040.1|2.341e-1373.33hypothetical protein RR48_00071 [Papilio machaon][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_5544contignewscf_5544:3454..3606 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025879-RAOSCA025879-RAOstrinia scapulalismRNAnewscf_5544 3454..3606 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025879-PA ID=OSCA025879-PA|Name=OSCA025879-RA|organism=Ostrinia scapulalis|type=polypeptide|length=50bp
VDRPLTRRTDDLVKVAGRTWMRAAQDRSLWKSLGEAFVQQWTSFGLNEQF
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity