OSCA025880-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025880-RA
Unique NameOSCA025880-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length95
Homology
BLAST of OSCA025880-RA vs. genbank:protein
Match: gi|512935605|ref|XP_004933314.1| (PREDICTED: uncharacterized protein LOC101739238 [Bombyx mori])

HSP 1 Score: 63.929 bits (154), Expect = 3.129e-11
Identity = 33/47 (70.21%), Postives = 35/47 (74.47%), Query Frame = 0
Query:   24 IQAPTATFTRSPGHLVGGLPTLRLPARGRHSRTFLPQRPSALQAMCP 70
            IQ   A F RS  HLVGG PTLRLP RGRHSR FLP RPS+L+AM P
Sbjct:   59 IQRDPALFIRSSVHLVGGRPTLRLPVRGRHSRIFLPHRPSSLRAMWP 105          
The following BLAST results are available for this feature:
BLAST of OSCA025880-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 1
Match NameE-valueIdentityDescription
gi|512935605|ref|XP_004933314.1|3.129e-1170.21PREDICTED: uncharacterized protein LOC101739238 [B... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_26323contignewscf_26323:691..978 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025880-RAOSCA025880-RAOstrinia scapulalismRNAnewscf_26323 691..978 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025880-PA ID=OSCA025880-PA|Name=OSCA025880-RA|organism=Ostrinia scapulalis|type=polypeptide|length=95bp
ERRPLLDKGLPQGFPQRPVLRARIQAPTATFTRSPGHLVGGLPTLRLPAR
GRHSRTFLPQRPSALQAMCPAYCHLILAILRASQSLWLSYGSPYF
back to top