OSCA025881-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025881-RA
Unique NameOSCA025881-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length83
Homology
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|827558565|ref|XP_012550407.1| (PREDICTED: potassium voltage-gated channel protein Shab isoform X3 [Bombyx mori])

HSP 1 Score: 165.622 bits (418), Expect = 8.112e-46
Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
Query:    7 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD
Sbjct:   58 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 134          
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|827558563|ref|XP_012550406.1| (PREDICTED: potassium voltage-gated channel protein Shab isoform X2 [Bombyx mori])

HSP 1 Score: 165.622 bits (418), Expect = 9.249e-46
Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
Query:    7 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD
Sbjct:   58 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 134          
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|827558559|ref|XP_004931651.2| (PREDICTED: potassium voltage-gated channel protein Shab isoform X1 [Bombyx mori] >gi|827558561|ref|XP_012550405.1| PREDICTED: potassium voltage-gated channel protein Shab isoform X1 [Bombyx mori])

HSP 1 Score: 165.236 bits (417), Expect = 1.020e-45
Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
Query:    7 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD
Sbjct:   58 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 134          
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|732586829|gb|JAG08838.1| (Potassium voltage-gated channel protein Shab, partial [Lygus hesperus])

HSP 1 Score: 151.754 bits (382), Expect = 2.028e-45
Identity = 68/76 (89.47%), Postives = 75/76 (98.68%), Query Frame = 0
Query:    8 RSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            RSMSSLPPEPFM++R+KAL++RV+INVGGV+HEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSL DNEYFFD
Sbjct:   11 RSMSSLPPEPFMIMRSKALNRRVVINVGGVKHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLMDNEYFFD 86          
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|1058131805|gb|JAS69551.1| (hypothetical protein g.50600, partial [Cuerna arida])

HSP 1 Score: 149.828 bits (377), Expect = 2.261e-45
Identity = 69/77 (89.61%), Postives = 75/77 (97.40%), Query Frame = 0
Query:    7 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            SRSMSSLPPEPFM++R+KAL++RV INVGGV+HEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSL DNEYFFD
Sbjct:   25 SRSMSSLPPEPFMIMRSKALNRRVCINVGGVKHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLIDNEYFFD 101          
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|909570118|ref|XP_013140591.1| (PREDICTED: potassium voltage-gated channel protein Shab-like [Papilio polytes])

HSP 1 Score: 152.525 bits (384), Expect = 2.473e-45
Identity = 70/74 (94.59%), Postives = 72/74 (97.30%), Query Frame = 0
Query:   10 MSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            MSSLPPEPFMMLRAKALSKRVIINVGGVRHEV+W TLERLPHTRLGRLRDCNTHEAI ELC+DYSLQDNEYFFD
Sbjct:    1 MSSLPPEPFMMLRAKALSKRVIINVGGVRHEVMWSTLERLPHTRLGRLRDCNTHEAIIELCNDYSLQDNEYFFD 74          
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|913319457|ref|XP_013190800.1| (PREDICTED: potassium voltage-gated channel protein Shab [Amyelois transitella])

HSP 1 Score: 163.31 bits (412), Expect = 4.962e-45
Identity = 76/77 (98.70%), Postives = 76/77 (98.70%), Query Frame = 0
Query:    7 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAI ELCDDYSLQDNEYFFD
Sbjct:   61 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAIIELCDDYSLQDNEYFFD 137          
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|768428352|ref|XP_011555309.1| (PREDICTED: potassium voltage-gated channel protein Shab, partial [Plutella xylostella])

HSP 1 Score: 159.458 bits (402), Expect = 1.210e-44
Identity = 73/77 (94.81%), Postives = 76/77 (98.70%), Query Frame = 0
Query:    7 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            SRSMSSLPPEPFMMLR+KALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTH+AI E+CDDYSLQDNEYFFD
Sbjct:   57 SRSMSSLPPEPFMMLRSKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHDAIVEICDDYSLQDNEYFFD 133          
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|930666111|gb|KPJ07234.1| (Potassium voltage-gated channel protein Shab [Papilio machaon])

HSP 1 Score: 155.992 bits (393), Expect = 1.762e-44
Identity = 73/77 (94.81%), Postives = 75/77 (97.40%), Query Frame = 0
Query:    7 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEV+W TLERLPHTRLGRLRDCNTHEAI ELC+DYSLQDNEYFFD
Sbjct:   64 SRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVMWSTLERLPHTRLGRLRDCNTHEAIIELCNDYSLQDNEYFFD 140          
BLAST of OSCA025881-RA vs. genbank:protein
Match: gi|357605995|gb|EHJ64864.1| (hypothetical protein KGM_14717 [Danaus plexippus])

HSP 1 Score: 160.999 bits (406), Expect = 2.960e-44
Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
Query:   10 MSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 83
            MSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD
Sbjct:    1 MSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD 74          
The following BLAST results are available for this feature:
BLAST of OSCA025881-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|827558565|ref|XP_012550407.1|8.112e-46100.00PREDICTED: potassium voltage-gated channel protein... [more]
gi|827558563|ref|XP_012550406.1|9.249e-46100.00PREDICTED: potassium voltage-gated channel protein... [more]
gi|827558559|ref|XP_004931651.2|1.020e-45100.00PREDICTED: potassium voltage-gated channel protein... [more]
gi|732586829|gb|JAG08838.1|2.028e-4589.47Potassium voltage-gated channel protein Shab, part... [more]
gi|1058131805|gb|JAS69551.1|2.261e-4589.61hypothetical protein g.50600, partial [Cuerna arid... [more]
gi|909570118|ref|XP_013140591.1|2.473e-4594.59PREDICTED: potassium voltage-gated channel protein... [more]
gi|913319457|ref|XP_013190800.1|4.962e-4598.70PREDICTED: potassium voltage-gated channel protein... [more]
gi|768428352|ref|XP_011555309.1|1.210e-4494.81PREDICTED: potassium voltage-gated channel protein... [more]
gi|930666111|gb|KPJ07234.1|1.762e-4494.81Potassium voltage-gated channel protein Shab [Papi... [more]
gi|357605995|gb|EHJ64864.1|2.960e-44100.00hypothetical protein KGM_14717 [Danaus plexippus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0071805 potassium ion transmembrane transport
biological_process GO:0006813 potassium ion transport
biological_process GO:0051260 protein homooligomerization
biological_process GO:0034765 regulation of ion transmembrane transport
cellular_component GO:0008076 voltage-gated potassium channel complex
molecular_function GO:0005249 voltage-gated potassium channel activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003971Potassium channel, voltage dependent, Kv9PRINTSPR01494KV9CHANNELcoord: 48..64
score: 56.62
coord: 33..45
score: 48.08
coord: 71..83
score: 53.57
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 30..83
e-value: 9.4E-13
score: 48.0
NoneNo IPR availableGENE3D3.30.710.10coord: 29..83
e-value: 2.4E-12
score: 46.5
NoneNo IPR availablePANTHERPTHR11537:SF110SUBFAMILY NOT NAMEDcoord: 25..83
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 25..83
IPR011333BTB/POZ foldSUPERFAMILY54695POZ domaincoord: 28..83

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_39208contignewscf_39208:605..853 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025881-RAOSCA025881-RAOstrinia scapulalismRNAnewscf_39208 605..853 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025881-PA ID=OSCA025881-PA|Name=OSCA025881-RA|organism=Ostrinia scapulalis|type=polypeptide|length=83bp
MVFSNVSRSMSSLPPEPFMMLRAKALSKRVIINVGGVRHEVLWRTLERLP
HTRLGRLRDCNTHEAITELCDDYSLQDNEYFFD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0034765regulation of ion transmembrane transport
GO:0051260protein homooligomerization
GO:0006813potassium ion transport
Vocabulary: Cellular Component
TermDefinition
GO:0008076voltage-gated potassium channel complex
Vocabulary: Molecular Function
TermDefinition
GO:0005249voltage-gated potassium channel activity
Vocabulary: INTERPRO
TermDefinition
IPR011333BTB/POZ_fold
IPR028325VG_K_chnl
IPR003131T1-type_BTB
IPR003971K_chnl_volt-dep_Kv9