OSCA025882-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025882-RA
Unique NameOSCA025882-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length89
Homology
BLAST of OSCA025882-RA vs. genbank:protein
Match: gi|509171691|gb|JAA83966.1| (endonuclease-reverse transcriptase [Pararge aegeria])

HSP 1 Score: 74.7146 bits (182), Expect = 1.128e-15
Identity = 34/54 (62.96%), Postives = 43/54 (79.63%), Query Frame = 0
Query:    2 AMARLVVQGQVEGKRARGRSPTRLIDAITKATESTMVQCTRDATYLQKWKHIAR 55
            ++ RLVVQGQVEGKRARGRSPTR ID +   T++T+V+C R AT  QKW+ +AR
Sbjct:   38 SIERLVVQGQVEGKRARGRSPTRWIDTVKSLTQTTVVECFRHATNRQKWRRLAR 91          
BLAST of OSCA025882-RA vs. genbank:protein
Match: gi|509163701|gb|JAA79971.1| (endonuclease-reverse transcriptase [Pararge aegeria])

HSP 1 Score: 63.1586 bits (152), Expect = 2.190e-11
Identity = 30/62 (48.39%), Postives = 41/62 (66.13%), Query Frame = 0
Query:    6 LVVQGQVEGKRARGRSPTRLIDAITKATESTMVQCTRDATYLQKWKHIARRATLGDDFEHPT 67
            LVV+G V GKR+RGRSPTR  D I  AT++++VQC+R+A    KW+ IA  A   ++    T
Sbjct:    9 LVVKGNVGGKRSRGRSPTRWTDVIKAATQTSIVQCSRNAEDRNKWRRIAGAAVAKENVSSLT 70          
The following BLAST results are available for this feature:
BLAST of OSCA025882-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 2
Match NameE-valueIdentityDescription
gi|509171691|gb|JAA83966.1|1.128e-1562.96endonuclease-reverse transcriptase [Pararge aegeri... [more]
gi|509163701|gb|JAA79971.1|2.190e-1148.39endonuclease-reverse transcriptase [Pararge aegeri... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_3726contignewscf_3726:28533..28802 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025882-RAOSCA025882-RAOstrinia scapulalismRNAnewscf_3726 28533..28802 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025882-PA ID=OSCA025882-PA|Name=OSCA025882-RA|organism=Ostrinia scapulalis|type=polypeptide|length=89bp
MAMARLVVQGQVEGKRARGRSPTRLIDAITKATESTMVQCTRDATYLQKW
KHIARRATLGDDFEHPTMYLPHQRNHDHSDKSARLRRNL
back to top