OSCA025883-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025883-RA
Unique NameOSCA025883-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length85
Homology
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|509176285|gb|JAA86263.1| (Microtubule-associated protein Jupiter [Pararge aegeria])

HSP 1 Score: 91.6633 bits (226), Expect = 6.159e-22
Identity = 47/57 (82.46%), Postives = 50/57 (87.72%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPR--GRRPAPSVVAAAAAG 55
            MTSTSFNVG+ D +RLSSRVLRPPGGGHTDIFGGEPEPPR  GRRPAPSV+A  A G
Sbjct:    1 MTSTSFNVGIGDGSRLSSRVLRPPGGGHTDIFGGEPEPPRAGGRRPAPSVLANMAQG 57          
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|357624442|gb|EHJ75224.1| (hypothetical protein KGM_13882 [Danaus plexippus])

HSP 1 Score: 90.8929 bits (224), Expect = 1.266e-21
Identity = 43/49 (87.76%), Postives = 45/49 (91.84%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPRGRRPAPSVV 49
            MTSTSFNVGL D  R SSRVLRPPGGGHTDIFGGEPEPPRGRRPAP++V
Sbjct:    1 MTSTSFNVGLNDGVRSSSRVLRPPGGGHTDIFGGEPEPPRGRRPAPALV 49          
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|768440332|ref|XP_011561835.1| (PREDICTED: hematological and neurological expressed 1 protein-like isoform X2 [Plutella xylostella] >gi|768440334|ref|XP_011561836.1| PREDICTED: hematological and neurological expressed 1 protein-like isoform X2 [Plutella xylostella] >gi|768440336|ref|XP_011561837.1| PREDICTED: hematological and neurological expressed 1 protein-like isoform X2 [Plutella xylostella])

HSP 1 Score: 81.2629 bits (199), Expect = 4.685e-18
Identity = 45/62 (72.58%), Postives = 46/62 (74.19%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPR--GRRPAPSVVAAAAAGGYLNL 60
            MTSTSFNVGL D  R+SSRVLRPPGGGHTDIFGGEPEPPR  GRR    V  A AAGG    
Sbjct:    1 MTSTSFNVGLGDGDRVSSRVLRPPGGGHTDIFGGEPEPPRTTGRR---MVPGATAAGGQFEY 59          
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|768440330|ref|XP_011561834.1| (PREDICTED: hematological and neurological expressed 1 protein-like isoform X1 [Plutella xylostella])

HSP 1 Score: 81.6481 bits (200), Expect = 4.918e-18
Identity = 45/62 (72.58%), Postives = 46/62 (74.19%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPR--GRRPAPSVVAAAAAGGYLNL 60
            MTSTSFNVGL D  R+SSRVLRPPGGGHTDIFGGEPEPPR  GRR    V  A AAGG    
Sbjct:    8 MTSTSFNVGLGDGDRVSSRVLRPPGGGHTDIFGGEPEPPRTTGRR---MVPGATAAGGQFEY 66          
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|768445816|ref|XP_011564825.1| (PREDICTED: hematological and neurological expressed 1 protein-like [Plutella xylostella] >gi|768445818|ref|XP_011564826.1| PREDICTED: hematological and neurological expressed 1 protein-like [Plutella xylostella] >gi|768445820|ref|XP_011564827.1| PREDICTED: hematological and neurological expressed 1 protein-like [Plutella xylostella])

HSP 1 Score: 81.2629 bits (199), Expect = 5.700e-18
Identity = 45/62 (72.58%), Postives = 46/62 (74.19%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPR--GRRPAPSVVAAAAAGGYLNL 60
            MTSTSFNVGL D  R+SSRVLRPPGGGHTDIFGGEPEPPR  GRR    V  A AAGG    
Sbjct:    1 MTSTSFNVGLGDGDRVSSRVLRPPGGGHTDIFGGEPEPPRTTGRR---MVPGATAAGGQFEY 59          
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|913311176|ref|XP_013186255.1| (PREDICTED: proline-rich protein 2 [Amyelois transitella] >gi|913311178|ref|XP_013186256.1| PREDICTED: proline-rich protein 2 [Amyelois transitella])

HSP 1 Score: 81.6481 bits (200), Expect = 6.477e-18
Identity = 40/51 (78.43%), Postives = 43/51 (84.31%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPRGRRPAPSVVAA 51
            MTSTSFNVGL +  R+SSRVLRPPGGGHTDIFGG+PEPPRGRR  P V  A
Sbjct:    1 MTSTSFNVGLGEAPRMSSRVLRPPGGGHTDIFGGDPEPPRGRRQFPGVANA 51          
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|1073525387|gb|JAT79805.1| (hypothetical protein g.17165, partial [Pectinophora gossypiella])

HSP 1 Score: 77.7962 bits (190), Expect = 3.513e-16
Identity = 37/47 (78.72%), Postives = 39/47 (82.98%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPRGRRPAPS 47
            MTST FNVGL+DN RLSSRVLRPPGG HTDIFG EPEP + RR  PS
Sbjct:   42 MTSTPFNVGLSDNKRLSSRVLRPPGGAHTDIFGAEPEPLKTRRHIPS 88          
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|910326288|ref|XP_013166282.1| (PREDICTED: translation initiation factor IF-2 [Papilio xuthus] >gi|910326290|ref|XP_013166283.1| PREDICTED: translation initiation factor IF-2 [Papilio xuthus])

HSP 1 Score: 76.6406 bits (187), Expect = 5.646e-16
Identity = 39/53 (73.58%), Postives = 44/53 (83.02%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPR-GRRPAPSVVAAA 52
            MTST F+VGL+D+TR+SSRVLRPPGGGHTDIFG EPEP R GRRP P+    A
Sbjct:    3 MTSTPFSVGLSDDTRVSSRVLRPPGGGHTDIFGSEPEPLRVGRRPGPNATVPA 55          
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|909555557|ref|XP_013149290.1| (PREDICTED: oleosin-B6-like [Papilio polytes] >gi|909555559|ref|XP_013149291.1| PREDICTED: oleosin-B6-like [Papilio polytes])

HSP 1 Score: 76.2554 bits (186), Expect = 6.830e-16
Identity = 39/53 (73.58%), Postives = 44/53 (83.02%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPR-GRRPAPSVVAAA 52
            MTST F+VGL+D+TR+SSRVLRPPGGGHTDIFG EPEP R GRRP P+    A
Sbjct:    3 MTSTPFSVGLSDDTRVSSRVLRPPGGGHTDIFGSEPEPLRVGRRPGPNATVPA 55          
BLAST of OSCA025883-RA vs. genbank:protein
Match: gi|512893839|ref|XP_004923280.1| (PREDICTED: hematological and neurological expressed 1 protein-like [Bombyx mori])

HSP 1 Score: 72.0182 bits (175), Expect = 2.640e-14
Identity = 37/47 (78.72%), Postives = 38/47 (80.85%), Query Frame = 0
Query:    1 MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPR-GRRPAP 46
            MTST FNVGL D  RLSSRVLRPPGGGHT+IF  EPEPPR GRR  P
Sbjct:    1 MTSTPFNVGLNDGARLSSRVLRPPGGGHTNIFDSEPEPPRTGRRAVP 47          
The following BLAST results are available for this feature:
BLAST of OSCA025883-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 12
Match NameE-valueIdentityDescription
gi|509176285|gb|JAA86263.1|6.159e-2282.46Microtubule-associated protein Jupiter [Pararge ae... [more]
gi|357624442|gb|EHJ75224.1|1.266e-2187.76hypothetical protein KGM_13882 [Danaus plexippus][more]
gi|768440332|ref|XP_011561835.1|4.685e-1872.58PREDICTED: hematological and neurological expresse... [more]
gi|768440330|ref|XP_011561834.1|4.918e-1872.58PREDICTED: hematological and neurological expresse... [more]
gi|768445816|ref|XP_011564825.1|5.700e-1872.58PREDICTED: hematological and neurological expresse... [more]
gi|913311176|ref|XP_013186255.1|6.477e-1878.43PREDICTED: proline-rich protein 2 [Amyelois transi... [more]
gi|1073525387|gb|JAT79805.1|3.513e-1678.72hypothetical protein g.17165, partial [Pectinophor... [more]
gi|910326288|ref|XP_013166282.1|5.646e-1673.58PREDICTED: translation initiation factor IF-2 [Pap... [more]
gi|909555557|ref|XP_013149290.1|6.830e-1673.58PREDICTED: oleosin-B6-like [Papilio polytes] >gi|9... [more]
gi|512893839|ref|XP_004923280.1|2.640e-1478.72PREDICTED: hematological and neurological expresse... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_28943contignewscf_28943:836..1093 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025883-RAOSCA025883-RAOstrinia scapulalismRNAnewscf_28943 836..1093 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025883-PA ID=OSCA025883-PA|Name=OSCA025883-RA|organism=Ostrinia scapulalis|type=polypeptide|length=85bp
MTSTSFNVGLTDNTRLSSRVLRPPGGGHTDIFGGEPEPPRGRRPAPSVVA
AAAAGGYLNLTNWTLRSRIIISATGRPLLNIGLLQ
back to top