OSCA025884-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025884-RA
Unique NameOSCA025884-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length148
Homology
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|456005201|gb|AGG36456.1| (glycosyltransferase 1 [Chilo suppressalis])

HSP 1 Score: 294.278 bits (752), Expect = 3.030e-96
Identity = 140/147 (95.24%), Postives = 142/147 (96.60%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFL 147
            MKVKKDSVELDLRPRYPLFGGW+THYTLGYNVPSYEYLYHS NEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKL +PY VTRLPDSLHYTYLDTKGRPVITFKK NLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLY LFL
Sbjct:  301 MKVKKDSVELDLRPRYPLFGGWRTHYTLGYNVPSYEYLYHSGNEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLNIPYPVTRLPDSLHYTYLDTKGRPVITFKKNNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYALFL 447          
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|357610449|gb|EHJ66983.1| (ribophorin [Danaus plexippus])

HSP 1 Score: 277.33 bits (708), Expect = 8.372e-94
Identity = 129/147 (87.76%), Postives = 139/147 (94.56%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFL 147
            MKVKKDSVELDLRPRYPLFGGW++HYTLGYNVPSYEYLYHS NEYLLKMR +DH+FDDMQ+DEL TKIILPEGST IK+  P+ VTRLPDSLHYTYLDTKGRPVITFKK+N+VENHIQDFQLRYTFPR+LMLQEPLLVVGFLY LFL
Sbjct:    1 MKVKKDSVELDLRPRYPLFGGWRSHYTLGYNVPSYEYLYHSGNEYLLKMRAVDHVFDDMQIDELVTKIILPEGSTSIKINFPFAVTRLPDSLHYTYLDTKGRPVITFKKSNVVENHIQDFQLRYTFPRILMLQEPLLVVGFLYALFL 147          
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|930658050|gb|KPJ00258.1| (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [Papilio xuthus])

HSP 1 Score: 275.404 bits (703), Expect = 4.393e-93
Identity = 129/147 (87.76%), Postives = 140/147 (95.24%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFL 147
            MK+KKDSVELDLRPRYPLFGGW++HYTLGYNVPSYEYLYHS NEYLLKMRV+DHIFDDMQ+DEL TKI+LPEGST IK+ +PY VTRLPD+LHYTYLDTKGRPVITF KTN+VENHIQDFQLRYTFPR+LMLQEPLLVVGFLY LFL
Sbjct:    1 MKIKKDSVELDLRPRYPLFGGWRSHYTLGYNVPSYEYLYHSGNEYLLKMRVVDHIFDDMQIDELITKIVLPEGSTNIKINIPYSVTRLPDTLHYTYLDTKGRPVITFTKTNVVENHIQDFQLRYTFPRILMLQEPLLVVGFLYLLFL 147          
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|512931880|ref|XP_004932409.1| (PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [Bombyx mori])

HSP 1 Score: 285.034 bits (728), Expect = 1.351e-92
Identity = 134/147 (91.16%), Postives = 140/147 (95.24%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFL 147
            MKVKKDSVELDLRPRYPLFGGW+THYTLGYNVPSYEYLYHS NEYLLKMR IDHIFDDMQVDEL TKIILPEGSTGIKL +PY VTRLPDSLH+TYLDTKGRPVI+F K N+VENHIQDFQ+RYTFPRLLMLQEPLLVVGFLYTLFL
Sbjct:  303 MKVKKDSVELDLRPRYPLFGGWRTHYTLGYNVPSYEYLYHSGNEYLLKMRSIDHIFDDMQVDELVTKIILPEGSTGIKLNIPYSVTRLPDSLHFTYLDTKGRPVISFIKKNIVENHIQDFQIRYTFPRLLMLQEPLLVVGFLYTLFL 449          
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|909556148|ref|XP_013149603.1| (PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [Papilio polytes])

HSP 1 Score: 282.337 bits (721), Expect = 1.496e-91
Identity = 129/147 (87.76%), Postives = 140/147 (95.24%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFL 147
            MK+KKDSVELDLRPRYPLFGGW++HYTLGYNVPSYEYLYHS NEYLLKMRV+DHIFDDMQ+DEL TKI+LPEGST +K+ +PY VTRLPDSLHYTYLDTKGRPVITF KTN+VENHIQDFQLRYTFPR+LMLQEPLLVVGFLY LFL
Sbjct:  302 MKIKKDSVELDLRPRYPLFGGWRSHYTLGYNVPSYEYLYHSGNEYLLKMRVVDHIFDDMQIDELVTKIVLPEGSTNVKINIPYSVTRLPDSLHYTYLDTKGRPVITFTKTNVVENHIQDFQLRYTFPRILMLQEPLLVVGFLYLLFL 448          
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|943968216|ref|XP_014366011.1| (PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [Papilio machaon] >gi|930668404|gb|KPJ09440.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [Papilio machaon])

HSP 1 Score: 281.952 bits (720), Expect = 2.309e-91
Identity = 131/147 (89.12%), Postives = 139/147 (94.56%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFL 147
            MKVKKDSVELDLRPRYPLFGGW++HYTLGYNVPSYEYLYHS NEYLLKMRV+DHIFDDMQ+DEL TKI+LPEGST IK+  PY VTRLPDSLHYTYLDTKGRPVITF KTN+VENHIQDFQLRYTFPR+LMLQEPLLVVGFLY LFL
Sbjct:  302 MKVKKDSVELDLRPRYPLFGGWRSHYTLGYNVPSYEYLYHSGNEYLLKMRVVDHIFDDMQIDELITKIVLPEGSTNIKINTPYSVTRLPDSLHYTYLDTKGRPVITFTKTNVVENHIQDFQLRYTFPRILMLQEPLLVVGFLYLLFL 448          
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|910343985|ref|XP_013175793.1| (PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [Papilio xuthus])

HSP 1 Score: 280.411 bits (716), Expect = 7.059e-91
Identity = 129/147 (87.76%), Postives = 140/147 (95.24%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFL 147
            MK+KKDSVELDLRPRYPLFGGW++HYTLGYNVPSYEYLYHS NEYLLKMRV+DHIFDDMQ+DEL TKI+LPEGST IK+ +PY VTRLPD+LHYTYLDTKGRPVITF KTN+VENHIQDFQLRYTFPR+LMLQEPLLVVGFLY LFL
Sbjct:  302 MKIKKDSVELDLRPRYPLFGGWRSHYTLGYNVPSYEYLYHSGNEYLLKMRVVDHIFDDMQIDELITKIVLPEGSTNIKINIPYSVTRLPDTLHYTYLDTKGRPVITFTKTNVVENHIQDFQLRYTFPRILMLQEPLLVVGFLYLLFL 448          
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|1073534315|gb|JAT84269.1| (hypothetical protein g.4979, partial [Pectinophora gossypiella])

HSP 1 Score: 274.248 bits (700), Expect = 1.358e-90
Identity = 130/147 (88.44%), Postives = 137/147 (93.20%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFL 147
            MKV+KDSVELDLRPRYPLFGGW+THYTLGYNVPSYEYLYHS NEYLLKMR++DHIFDDMQVDE T KIILPEGS+ IK+  PY V RLPDSLHYTYLDTKGRPVI FKKTNLVE+HIQDFQLRYTFPRLLMLQEPLLVVGFLY LFL
Sbjct:  140 MKVRKDSVELDLRPRYPLFGGWRTHYTLGYNVPSYEYLYHSGNEYLLKMRLVDHIFDDMQVDEATVKIILPEGSSHIKVNTPYTVKRLPDSLHYTYLDTKGRPVIAFKKTNLVESHIQDFQLRYTFPRLLMLQEPLLVVGFLYALFL 286          
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|913315625|ref|XP_013188708.1| (PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [Amyelois transitella])

HSP 1 Score: 278.1 bits (710), Expect = 5.865e-90
Identity = 132/148 (89.19%), Postives = 139/148 (93.92%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFLF 148
            MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYL+ S N++LLKMRVIDHIFDDMQVDE+ TKIILPEGS+ IKL LPY VTRLPDSLHYTYLDTKGRPVITFKK N+VENHIQDFQLRYTFPRLLMLQEPLLVVGFL+ LFL 
Sbjct:  299 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLFSSGNDFLLKMRVIDHIFDDMQVDEVITKIILPEGSSNIKLNLPYPVTRLPDSLHYTYLDTKGRPVITFKKENVVENHIQDFQLRYTFPRLLMLQEPLLVVGFLHALFLL 446          
BLAST of OSCA025884-RA vs. genbank:protein
Match: gi|768411316|ref|XP_011563062.1| (PREDICTED: LOW QUALITY PROTEIN: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [Plutella xylostella])

HSP 1 Score: 276.559 bits (706), Expect = 3.051e-89
Identity = 128/147 (87.07%), Postives = 138/147 (93.88%), Query Frame = 0
Query:    1 MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMRVIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTKGRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFL 147
            M+VKKDSVELDLRPRYPLFGGW+THYTLGYNVPSYEYLYHS N+YLLKMR+IDHIFDDMQVDE+ TKIILPEG+ G+KL LPY VTRLPD+LH+TYLDTKGRPVITF K N+VENHIQDFQLRYTFPRLLM QEPLLVVGFLY LFL
Sbjct:  306 MRVKKDSVELDLRPRYPLFGGWRTHYTLGYNVPSYEYLYHSGNDYLLKMRIIDHIFDDMQVDEVVTKIILPEGTAGLKLNLPYAVTRLPDTLHHTYLDTKGRPVITFIKKNVVENHIQDFQLRYTFPRLLMFQEPLLVVGFLYALFL 452          
The following BLAST results are available for this feature:
BLAST of OSCA025884-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|456005201|gb|AGG36456.1|3.030e-9695.24glycosyltransferase 1 [Chilo suppressalis][more]
gi|357610449|gb|EHJ66983.1|8.372e-9487.76ribophorin [Danaus plexippus][more]
gi|930658050|gb|KPJ00258.1|4.393e-9387.76Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
gi|512931880|ref|XP_004932409.1|1.351e-9291.16PREDICTED: dolichyl-diphosphooligosaccharide--prot... [more]
gi|909556148|ref|XP_013149603.1|1.496e-9187.76PREDICTED: dolichyl-diphosphooligosaccharide--prot... [more]
gi|943968216|ref|XP_014366011.1|2.309e-9189.12PREDICTED: dolichyl-diphosphooligosaccharide--prot... [more]
gi|910343985|ref|XP_013175793.1|7.059e-9187.76PREDICTED: dolichyl-diphosphooligosaccharide--prot... [more]
gi|1073534315|gb|JAT84269.1|1.358e-9088.44hypothetical protein g.4979, partial [Pectinophora... [more]
gi|913315625|ref|XP_013188708.1|5.865e-9089.19PREDICTED: dolichyl-diphosphooligosaccharide--prot... [more]
gi|768411316|ref|XP_011563062.1|3.051e-8987.07PREDICTED: LOW QUALITY PROTEIN: dolichyl-diphospho... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006486 protein glycosylation
cellular_component GO:0005783 endoplasmic reticulum
cellular_component GO:0005789 endoplasmic reticulum membrane
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007676Ribophorin IPFAMPF04597Ribophorin_Icoord: 3..148
e-value: 2.3E-52
score: 177.8
IPR007676Ribophorin IPANTHERPTHR21049RIBOPHORIN Icoord: 1..148
NoneNo IPR availablePANTHERPTHR21049:SF0DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE SUBUNIT 1coord: 1..148
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..128
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 147..148
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 129..146

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_14996contignewscf_14996:1792..2235 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025884-RAOSCA025884-RAOstrinia scapulalismRNAnewscf_14996 1792..2235 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025884-PA ID=OSCA025884-PA|Name=OSCA025884-RA|organism=Ostrinia scapulalis|type=polypeptide|length=148bp
MKVKKDSVELDLRPRYPLFGGWKTHYTLGYNVPSYEYLYHSANEYLLKMR
VIDHIFDDMQVDELTTKIILPEGSTGIKLTLPYQVTRLPDSLHYTYLDTK
GRPVITFKKTNLVENHIQDFQLRYTFPRLLMLQEPLLVVGFLYTLFLF
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005789endoplasmic reticulum membrane
GO:0005783endoplasmic reticulum
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: Molecular Function
TermDefinition
GO:0004579dolichyl-diphosphooligosaccharide-protein glycotransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR007676Ribophorin_I