OSCA025885-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025885-RA
Unique NameOSCA025885-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length48
Homology
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|39938474|gb|AAK14384.2| (molt-regulating transcription factor HHR3 [Helicoverpa armigera])

HSP 1 Score: 102.834 bits (255), Expect = 2.101e-24
Identity = 45/48 (93.75%), Postives = 48/48 (100.00%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPHTE 48
            MNNNQFH+LFGSQWPPDQHGGHSSASTMLHQ+QGLPQGMQLKREPHT+
Sbjct:    1 MNNNQFHDLFGSQWPPDQHGGHSSASTMLHQSQGLPQGMQLKREPHTD 48          
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|198385545|gb|ACH86113.1| (molt-regulating transcription factor HaHR3 [Helicoverpa armigera])

HSP 1 Score: 102.449 bits (254), Expect = 2.365e-24
Identity = 45/48 (93.75%), Postives = 48/48 (100.00%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPHTE 48
            MNNNQFH+LFGSQWPPDQHGGHSSASTMLHQ+QGLPQGMQLKREPHT+
Sbjct:    1 MNNNQFHDLFGSQWPPDQHGGHSSASTMLHQSQGLPQGMQLKREPHTD 48          
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|6683577|dbj|BAA89260.1| (hormone receptor 3, partial [Bombyx mori])

HSP 1 Score: 91.6633 bits (226), Expect = 2.706e-22
Identity = 44/48 (91.67%), Postives = 45/48 (93.75%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPHTE 48
            MNNNQF ELFGSQWPPDQHGGHSSASTMLHQ Q LPQGMQLKREPHT+
Sbjct:    1 MNNNQFPELFGSQWPPDQHGGHSSASTMLHQ-QSLPQGMQLKREPHTD 47          
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|585482|sp|Q08882.1|HR3_MANSE (RecName: Full=Probable nuclear hormone receptor HR3; Short=mHR3; AltName: Full=Nuclear receptor subfamily 1 group F member 4 >gi|396804|emb|CAA52654.1| MHR3 [Manduca sexta])

HSP 1 Score: 93.2041 bits (230), Expect = 4.696e-21
Identity = 44/48 (91.67%), Postives = 45/48 (93.75%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPHTE 48
            MNNNQFHELFGSQWPPDQHGGHSSASTMLHQ Q +PQ MQLKREPHTE
Sbjct:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQ-QTMPQTMQLKREPHTE 47          
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|1708295|sp|P49868.1|HR3_GALME (RecName: Full=Probable nuclear hormone receptor HR3; Short=gHR3; AltName: Full=Nuclear receptor subfamily 1 group F member 4 >gi|409272|gb|AAA83401.1| GHR3 [Galleria mellonella])

HSP 1 Score: 93.2041 bits (230), Expect = 4.978e-21
Identity = 43/49 (87.76%), Postives = 46/49 (93.88%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQG-LPQGMQLKREPHTE 48
            MNN+QFHELFGSQWPPDQHGGHSSASTMLHQ Q  LPQGM+LKREPHT+
Sbjct:    1 MNNSQFHELFGSQWPPDQHGGHSSASTMLHQAQSPLPQGMRLKREPHTD 49          
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|827562240|ref|XP_012551819.1| (PREDICTED: hormone receptor 3 isoform X1 [Bombyx mori] >gi|827562242|ref|XP_012551820.1| PREDICTED: hormone receptor 3 isoform X1 [Bombyx mori] >gi|827562244|ref|XP_012551821.1| PREDICTED: hormone receptor 3 isoform X1 [Bombyx mori])

HSP 1 Score: 92.8189 bits (229), Expect = 7.715e-21
Identity = 44/48 (91.67%), Postives = 45/48 (93.75%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPHTE 48
            MNNNQF ELFGSQWPPDQHGGHSSASTMLHQ Q LPQGMQLKREPHT+
Sbjct:    1 MNNNQFPELFGSQWPPDQHGGHSSASTMLHQ-QSLPQGMQLKREPHTD 47          
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|909562928|ref|XP_013136657.1| (PREDICTED: probable nuclear hormone receptor HR3 isoform X1 [Papilio polytes] >gi|909562930|ref|XP_013136658.1| PREDICTED: probable nuclear hormone receptor HR3 isoform X1 [Papilio polytes] >gi|909562932|ref|XP_013136659.1| PREDICTED: probable nuclear hormone receptor HR3 isoform X1 [Papilio polytes] >gi|909562934|ref|XP_013136660.1| PREDICTED: probable nuclear hormone receptor HR3 isoform X1 [Papilio polytes] >gi|909562936|ref|XP_013136661.1| PREDICTED: probable nuclear hormone receptor HR3 isoform X1 [Papilio polytes])

HSP 1 Score: 86.2705 bits (212), Expect = 1.461e-18
Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPH 46
            MNNNQFHELFGSQWPPDQHGGHSSASTMLHQ   LPQ +QLKREPH
Sbjct:    2 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQQSQLPQ-VQLKREPH 46          
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|930654213|gb|KPI96548.1| (putative nuclear hormone receptor HR3 [Papilio xuthus])

HSP 1 Score: 85.5001 bits (210), Expect = 2.507e-18
Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPH 46
            MNNNQFHELFGSQWPPDQHGGHSSASTMLHQ   +PQ +QLKREPH
Sbjct:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQQSQIPQ-VQLKREPH 45          
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|943963411|ref|XP_014364018.1| (PREDICTED: probable nuclear hormone receptor HR3 isoform X5 [Papilio machaon])

HSP 1 Score: 85.5001 bits (210), Expect = 2.556e-18
Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPH 46
            MNNNQFHELFGSQWPPDQHGGHSSASTMLHQ   +PQ +QLKREPH
Sbjct:    2 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQPSQIPQ-VQLKREPH 46          
BLAST of OSCA025885-RA vs. genbank:protein
Match: gi|910346441|ref|XP_013177128.1| (PREDICTED: probable nuclear hormone receptor HR3 isoform X6 [Papilio xuthus])

HSP 1 Score: 85.5001 bits (210), Expect = 2.556e-18
Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
Query:    1 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPH 46
            MNNNQFHELFGSQWPPDQHGGHSSASTMLHQ   +PQ +QLKREPH
Sbjct:    2 MNNNQFHELFGSQWPPDQHGGHSSASTMLHQQSQIPQ-VQLKREPH 46          
The following BLAST results are available for this feature:
BLAST of OSCA025885-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|39938474|gb|AAK14384.2|2.101e-2493.75molt-regulating transcription factor HHR3 [Helicov... [more]
gi|198385545|gb|ACH86113.1|2.365e-2493.75molt-regulating transcription factor HaHR3 [Helico... [more]
gi|6683577|dbj|BAA89260.1|2.706e-2291.67hormone receptor 3, partial [Bombyx mori][more]
gi|585482|sp|Q08882.1|HR3_MANSE4.696e-2191.67RecName: Full=Probable nuclear hormone receptor HR... [more]
gi|1708295|sp|P49868.1|HR3_GALME4.978e-2187.76RecName: Full=Probable nuclear hormone receptor HR... [more]
gi|827562240|ref|XP_012551819.1|7.715e-2191.67PREDICTED: hormone receptor 3 isoform X1 [Bombyx m... [more]
gi|909562928|ref|XP_013136657.1|1.461e-1889.13PREDICTED: probable nuclear hormone receptor HR3 i... [more]
gi|930654213|gb|KPI96548.1|2.507e-1886.96putative nuclear hormone receptor HR3 [Papilio xut... [more]
gi|943963411|ref|XP_014364018.1|2.556e-1886.96PREDICTED: probable nuclear hormone receptor HR3 i... [more]
gi|910346441|ref|XP_013177128.1|2.556e-1886.96PREDICTED: probable nuclear hormone receptor HR3 i... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0030522 intracellular receptor signaling pathway
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0043401 steroid hormone mediated signaling pathway
cellular_component GO:0005634 nucleus
molecular_function GO:0043565 sequence-specific DNA binding
molecular_function GO:0003707 steroid hormone receptor activity
molecular_function GO:0004887 thyroid hormone receptor activity
molecular_function GO:0008270 zinc ion binding
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_12842contignewscf_12842:2347..2490 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025885-RAOSCA025885-RAOstrinia scapulalismRNAnewscf_12842 2347..2490 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025885-PA ID=OSCA025885-PA|Name=OSCA025885-RA|organism=Ostrinia scapulalis|type=polypeptide|length=48bp
MNNNQFHELFGSQWPPDQHGGHSSASTMLHQTQGLPQGMQLKREPHTE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0003707steroid hormone receptor activity
GO:0043565sequence-specific DNA binding
GO:0004887thyroid hormone receptor activity
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0030522intracellular receptor signaling pathway
GO:0043401steroid hormone mediated signaling pathway