OSCA025888-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025888-RA
Unique NameOSCA025888-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length75
Homology
BLAST of OSCA025888-RA vs. genbank:protein
Match: gi|930665739|gb|KPJ06866.1| (hypothetical protein RR48_11365 [Papilio machaon])

HSP 1 Score: 74.7146 bits (182), Expect = 3.449e-14
Identity = 39/56 (69.64%), Postives = 40/56 (71.43%), Query Frame = 0
Query:   10 ASPKDFHKDRSCTARIQAPFATLTRSSVHLVGGLPTLRLPARGRHSRTFLPQRPSL 65
            ASPKD H D SC  RIQ   ATLTRSSVHL GGL TLR P RGRHS T  P RPS+
Sbjct:  190 ASPKDRHDDGSCATRIQDTPATLTRSSVHLAGGLRTLRQPVRGRHSSTLRPHRPSI 245          
BLAST of OSCA025888-RA vs. genbank:protein
Match: gi|512935605|ref|XP_004933314.1| (PREDICTED: uncharacterized protein LOC101739238 [Bombyx mori])

HSP 1 Score: 67.781 bits (164), Expect = 4.702e-13
Identity = 37/56 (66.07%), Postives = 37/56 (66.07%), Query Frame = 0
Query:    9 KASPKDFHKDRSCTARIQAPFATLTRSSVHLVGGLPTLRLPARGRHSRTFLPQRPS 64
            K S  DF  DRS    IQ   A   RSSVHLVGG PTLRLP RGRHSR FLP RPS
Sbjct:   43 KISLADFQCDRSIATCIQRDPALFIRSSVHLVGGRPTLRLPVRGRHSRIFLPHRPS 98          
The following BLAST results are available for this feature:
BLAST of OSCA025888-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 2
Match NameE-valueIdentityDescription
gi|930665739|gb|KPJ06866.1|3.449e-1469.64hypothetical protein RR48_11365 [Papilio machaon][more]
gi|512935605|ref|XP_004933314.1|4.702e-1366.07PREDICTED: uncharacterized protein LOC101739238 [B... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_16437contignewscf_16437:520..744 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025888-RAOSCA025888-RAOstrinia scapulalismRNAnewscf_16437 520..744 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025888-PA ID=OSCA025888-PA|Name=OSCA025888-RA|organism=Ostrinia scapulalis|type=polypeptide|length=75bp
PKDVHCWTKASPKDFHKDRSCTARIQAPFATLTRSSVHLVGGLPTLRLPA
RGRHSRTFLPQRPSLQANLYEFICM
back to top