OSCA025889-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025889-RA
Unique NameOSCA025889-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length90
Homology
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|913308091|ref|XP_013184563.1| (PREDICTED: persulfide dioxygenase ETHE1, mitochondrial [Amyelois transitella])

HSP 1 Score: 176.022 bits (445), Expect = 1.594e-53
Identity = 80/90 (88.89%), Postives = 87/90 (96.67%), Query Frame = 0
Query:    1 GIAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
            GIAFTGDTLLIRGCGRTDFQEGSSE LYNSVH+KIFTLP++YTLYPAHDYRGQTAT+VGEEKKYNPRLTKSL+EF++IM  LNLPYPKMI
Sbjct:  157 GIAFTGDTLLIRGCGRTDFQEGSSEALYNSVHKKIFTLPDYYTLYPAHDYRGQTATSVGEEKKYNPRLTKSLQEFVDIMKNLNLPYPKMI 246          
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|389610077|dbj|BAM18650.1| (beta lactamase domain [Papilio xuthus])

HSP 1 Score: 168.318 bits (425), Expect = 1.299e-51
Identity = 77/89 (86.52%), Postives = 84/89 (94.38%), Query Frame = 0
Query:    2 IAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
            +AFTGDTLLIRGCGRTDFQEGSSE LY SVH +IFTLP+HYTLYPAHDY+GQTATTV EEKKYNPRLTK+L+EFI+IMD LNLPYPKMI
Sbjct:   74 MAFTGDTLLIRGCGRTDFQEGSSERLYQSVHNRIFTLPDHYTLYPAHDYKGQTATTVAEEKKYNPRLTKTLQEFIHIMDNLNLPYPKMI 162          
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|909579252|ref|XP_013145517.1| (PREDICTED: persulfide dioxygenase ETHE1, mitochondrial [Papilio polytes])

HSP 1 Score: 169.088 bits (427), Expect = 1.066e-50
Identity = 77/89 (86.52%), Postives = 83/89 (93.26%), Query Frame = 0
Query:    2 IAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
            +AFTGDTLLIRGCGRTDFQEGSS+ LY SVH KIFTLP+HYTLYPAHDYRGQTATTV EEKKYNPRLTK+L+EF+ IMD LNLPYPKMI
Sbjct:  164 MAFTGDTLLIRGCGRTDFQEGSSKRLYESVHNKIFTLPDHYTLYPAHDYRGQTATTVAEEKKYNPRLTKTLQEFVEIMDNLNLPYPKMI 252          
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|910310291|ref|XP_013163411.1| (PREDICTED: persulfide dioxygenase ETHE1, mitochondrial [Papilio xuthus])

HSP 1 Score: 168.703 bits (426), Expect = 1.560e-50
Identity = 77/90 (85.56%), Postives = 84/90 (93.33%), Query Frame = 0
Query:    1 GIAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
             +AFTGDTLLIRGCGRTDFQEGSSE LY SVH +IFTLP+HYTLYPAHDY+GQTATTV EEKKYNPRLTK+L+EFI+IMD LNLPYPKMI
Sbjct:  163 SMAFTGDTLLIRGCGRTDFQEGSSERLYLSVHNRIFTLPDHYTLYPAHDYKGQTATTVAEEKKYNPRLTKTLQEFIHIMDNLNLPYPKMI 252          
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|930650110|gb|KPI92456.1| (Protein ETHE1, mitochondrial [Papilio xuthus])

HSP 1 Score: 170.244 bits (430), Expect = 1.712e-50
Identity = 77/90 (85.56%), Postives = 84/90 (93.33%), Query Frame = 0
Query:    1 GIAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
             +AFTGDTLLIRGCGRTDFQEGSSE LY SVH +IFTLP+HYTLYPAHDY+GQTATTV EEKKYNPRLTK+L+EFI+IMD LNLPYPKMI
Sbjct:  218 SMAFTGDTLLIRGCGRTDFQEGSSERLYQSVHNRIFTLPDHYTLYPAHDYKGQTATTVAEEKKYNPRLTKTLQEFIHIMDNLNLPYPKMI 307          
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|357606542|gb|EHJ65108.1| (hypothetical protein KGM_16188 [Danaus plexippus])

HSP 1 Score: 162.155 bits (409), Expect = 2.404e-49
Identity = 76/90 (84.44%), Postives = 83/90 (92.22%), Query Frame = 0
Query:    1 GIAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
            GIAFTGDTLLIRGCGRTDFQEGS E LY SVH+KIFTLP HYTLYPAHDY+GQTAT+V EEKK+NPRLTK+L EFI+IM+ LNLPYPKMI
Sbjct:   69 GIAFTGDTLLIRGCGRTDFQEGSPETLYRSVHEKIFTLPGHYTLYPAHDYKGQTATSVDEEKKHNPRLTKTLPEFIDIMNNLNLPYPKMI 158          
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|512915215|ref|XP_004928335.1| (PREDICTED: persulfide dioxygenase ETHE1, mitochondrial [Bombyx mori] >gi|827551677|ref|XP_012547688.1| PREDICTED: persulfide dioxygenase ETHE1, mitochondrial [Bombyx mori])

HSP 1 Score: 163.31 bits (412), Expect = 2.046e-48
Identity = 74/89 (83.15%), Postives = 80/89 (89.89%), Query Frame = 0
Query:    2 IAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
            +AFTGDTLLIRGCGRTDFQEG+SE LY SVH +IFTLP+ Y LYPAHDYRGQTAT+V EEKKYNPRLTKSL EF+ IMD LNLPYPKMI
Sbjct:  163 LAFTGDTLLIRGCGRTDFQEGNSETLYKSVHNRIFTLPDEYVLYPAHDYRGQTATSVAEEKKYNPRLTKSLAEFVEIMDNLNLPYPKMI 251          
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|768433552|ref|XP_011558144.1| (PREDICTED: persulfide dioxygenase ETHE1, mitochondrial [Plutella xylostella] >gi|768433554|ref|XP_011558146.1| PREDICTED: persulfide dioxygenase ETHE1, mitochondrial [Plutella xylostella] >gi|768433556|ref|XP_011558147.1| PREDICTED: persulfide dioxygenase ETHE1, mitochondrial [Plutella xylostella])

HSP 1 Score: 162.54 bits (410), Expect = 3.804e-48
Identity = 75/90 (83.33%), Postives = 82/90 (91.11%), Query Frame = 0
Query:    1 GIAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
            GIAFTGDTLLIRGCGRTDFQ+GS E LY S++ KIFTLP++YTLYPAHDY+G TATTVGEEKKYNPRLTKSLEEF+ IM  LNLPYPKMI
Sbjct:  164 GIAFTGDTLLIRGCGRTDFQQGSPERLYQSIYSKIFTLPDNYTLYPAHDYKGLTATTVGEEKKYNPRLTKSLEEFVEIMKNLNLPYPKMI 253          
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|506965876|gb|AGM32290.1| (putative ETHE1 protein, partial [Coptotermes formosanus])

HSP 1 Score: 155.992 bits (393), Expect = 1.824e-45
Identity = 71/90 (78.89%), Postives = 80/90 (88.89%), Query Frame = 0
Query:    1 GIAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
            GIAFTGD LLIRGCGRTDFQEG+++ LYNSVH+ IFTLP+ + LYPAHDY+GQT TTVGEEK YNPRLTK L+EFI IM+ LNLPYPKMI
Sbjct:  177 GIAFTGDALLIRGCGRTDFQEGNAKTLYNSVHKYIFTLPDCFKLYPAHDYKGQTCTTVGEEKHYNPRLTKPLDEFIKIMENLNLPYPKMI 266          
BLAST of OSCA025889-RA vs. genbank:protein
Match: gi|242025339|ref|XP_002433082.1| (ETHE1 protein, putative [Pediculus humanus corporis] >gi|212518609|gb|EEB20344.1| ETHE1 protein, putative [Pediculus humanus corporis])

HSP 1 Score: 153.295 bits (386), Expect = 8.662e-45
Identity = 68/90 (75.56%), Postives = 81/90 (90.00%), Query Frame = 0
Query:    1 GIAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDYRGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI 90
            G+AFTGD LLIRGCGRTDFQEGSS+ LYNSVH +IFTLP++Y L+PAHDY+GQT+TTV EEK +NPRLTKS++EFI+IM  LNL YPK+I
Sbjct:  138 GLAFTGDALLIRGCGRTDFQEGSSKTLYNSVHSQIFTLPDNYRLFPAHDYKGQTSTTVAEEKMFNPRLTKSIDEFIDIMSKLNLSYPKLI 227          
The following BLAST results are available for this feature:
BLAST of OSCA025889-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913308091|ref|XP_013184563.1|1.594e-5388.89PREDICTED: persulfide dioxygenase ETHE1, mitochond... [more]
gi|389610077|dbj|BAM18650.1|1.299e-5186.52beta lactamase domain [Papilio xuthus][more]
gi|909579252|ref|XP_013145517.1|1.066e-5086.52PREDICTED: persulfide dioxygenase ETHE1, mitochond... [more]
gi|910310291|ref|XP_013163411.1|1.560e-5085.56PREDICTED: persulfide dioxygenase ETHE1, mitochond... [more]
gi|930650110|gb|KPI92456.1|1.712e-5085.56Protein ETHE1, mitochondrial [Papilio xuthus][more]
gi|357606542|gb|EHJ65108.1|2.404e-4984.44hypothetical protein KGM_16188 [Danaus plexippus][more]
gi|512915215|ref|XP_004928335.1|2.046e-4883.15PREDICTED: persulfide dioxygenase ETHE1, mitochond... [more]
gi|768433552|ref|XP_011558144.1|3.804e-4883.33PREDICTED: persulfide dioxygenase ETHE1, mitochond... [more]
gi|506965876|gb|AGM32290.1|1.824e-4578.89putative ETHE1 protein, partial [Coptotermes formo... [more]
gi|242025339|ref|XP_002433082.1|8.662e-4575.56ETHE1 protein, putative [Pediculus humanus corpori... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0004416 hydroxyacylglutathione hydrolase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001279Beta-lactamase-likeGENE3D3.60.15.10coord: 2..83
e-value: 2.0E-22
score: 79.2
IPR001279Beta-lactamase-likeSUPERFAMILY56281Metallo-hydrolase/oxidoreductasecoord: 2..80
NoneNo IPR availablePANTHERPTHR11935BETA LACTAMASE DOMAINcoord: 4..90
NoneNo IPR availablePANTHERPTHR11935:SF60SUBFAMILY NOT NAMEDcoord: 4..90

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_44739contignewscf_44739:485..754 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025889-RAOSCA025889-RAOstrinia scapulalismRNAnewscf_44739 485..754 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025889-PA ID=OSCA025889-PA|Name=OSCA025889-RA|organism=Ostrinia scapulalis|type=polypeptide|length=90bp
GIAFTGDTLLIRGCGRTDFQEGSSEGLYNSVHQKIFTLPEHYTLYPAHDY
RGQTATTVGEEKKYNPRLTKSLEEFINIMDTLNLPYPKMI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004416hydroxyacylglutathione hydrolase activity
Vocabulary: INTERPRO
TermDefinition
IPR001279Beta-lactamas-like