OSCA025890-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025890-RA
Unique NameOSCA025890-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length186
Homology
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|943953443|ref|XP_014359615.1| (PREDICTED: zinc finger protein 28-like [Papilio machaon])

HSP 1 Score: 184.111 bits (466), Expect = 2.350e-53
Identity = 81/186 (43.55%), Postives = 126/186 (67.74%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNNDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            LK HL+ +H   I+ +NDG+LP+KI+++ ++C+LC  KFE F+ LN H+N H+  +IC+QCG+GF +  RLR H   H  G++PCEEC KVF   T +  HI  +H   K+++C  C E F+NY+Q+ +H+   HG+ ++ FKC LCP++F+ SG LR H R  H+K + + CE+C+++ + K  L
Sbjct:  134 LKYHLMDRHDMYIN-SNDGILPFKISKDNFVCILCSTKFETFKSLNHHMNVHFQNYICEQCGSGFITPDRLRAHSVIHVNGSFPCEECHKVFRSNTARTEHIANIHKKCKRHRCPECHEGFRNYFQRNKHISSVHGMTLKEFKCDLCPRVFNLSGKLRVHFRTVHLKMKRYTCEVCDWKFYSKSEL 318          
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|357631483|gb|EHJ78956.1| (hypothetical protein KGM_06924 [Danaus plexippus])

HSP 1 Score: 188.734 bits (478), Expect = 2.695e-53
Identity = 85/187 (45.45%), Postives = 124/187 (66.31%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNN-DGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            LK HL+ KH   I LN+ DG+LP++IT+N + C +C   F++F  LN H+N HY  FIC+QCGAGF +  RLR H  +H++G++PC  C KVF  +  K  H   VH   K+++C +C E F NY+Q+ +H+   HG+K++ FKC+LCPK+F+ SG L  H R  H+K +  AC+LCE++ + K  L
Sbjct:    4 LKRHLVTKHSVNIQLNSQDGLLPFRITKNSFPCAVCGENFDEFTTLNHHMNVHYQNFICEQCGAGFMTPDRLRTHAFTHEMGSFPCHVCDKVFRSMNAKNEHYSIVHKKVKRHRCPHCPETFHNYFQRNKHISSFHGMKLKEFKCTLCPKVFTSSGKLGVHTRTVHLKMKRHACDLCEWKFYSKSEL 190          

HSP 2 Score: 125.176 bits (313), Expect = 5.147e-30
Identity = 65/189 (34.39%), Postives = 108/189 (57.14%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKI--TENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            LK HL  +HQK ID +  D ++P+K+   +  + CV+CE  F +  +L  H++ H++ + C+ CG+GF +   L++H+E H+ G +PCE+C KVF     + +H++ VHL     +C  C E F + Y++  HL D H    R+ KC  C + F+    L CH R  H++ +   C++C  +  +K TL
Sbjct:  399 LKVHLKEEHQKIIDPDLQDNMIPFKLEPQDGSFKCVICEETFIKVRILVIHMSVHFSNYSCEICGSGFMTLRLLKKHLEVHETGNFPCEKCNKVFSTPYKRSLHVRGVHLKQYPRRCPICPERFNSNYRRTIHLQDVHNQSTRVHKCETCGRGFNLKYHLICHTRSVHLQERNHQCKVCLQRFCNKETL 587          
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|827548047|ref|XP_012546282.1| (PREDICTED: gastrula zinc finger protein XlCGF26.1-like [Bombyx mori])

HSP 1 Score: 179.489 bits (454), Expect = 4.840e-53
Identity = 78/187 (41.71%), Postives = 124/187 (66.31%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            +++H+   H+K ++L   DG+LP+K++  E+ C +CE  + +F+ LN H+N H+  +IC+QCG+GF +  RLR H  +H  G+YPC  C K F     K  H   VHL AK+++C +C ELF NY+Q+ +H+   HG+K++ FKCS+CPK+F+ SG L  H +  H+K + +AC++CE+Q + K  L
Sbjct:   12 IRNHIAAVHKKKLNLEIGDGILPFKLSIGEFKCAVCEVDYGEFKTLNHHMNVHFPYYICEQCGSGFMTPQRLRNHALTHDTGSYPCTVCNKSFRSTNAKNDHYAIVHLKAKRHRCPHCCELFSNYFQRNKHISSVHGLKLKEFKCSVCPKVFTVSGKLGVHMKSVHLKMKRYACDVCEWQFYSKSEL 198          
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|910311361|ref|XP_013163599.1| (PREDICTED: zinc finger protein 675 isoform X4 [Papilio xuthus])

HSP 1 Score: 184.496 bits (467), Expect = 7.991e-52
Identity = 81/186 (43.55%), Postives = 126/186 (67.74%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNNDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            LK HL+ +H   I+ +NDG+LP+KI+++ ++C+LC  KFE F+ LN H+N H+  +IC+QCG+GF +  RLR H   H  G++PCEEC KVF   T +  HI  +H   K+++C  C E F+NY+Q+ +H+   HG+ ++ FKC LCP++F+ SG LR H R  H+K + + CE+C+++ + K  L
Sbjct:  340 LKYHLMDRHDMYIN-SNDGILPFKISKDNFVCILCSTKFETFKSLNHHMNVHFQNYICEQCGSGFITPDRLRAHSVIHVNGSFPCEECHKVFRSNTARTEHIANIHKKCKRHRCPECHEGFRNYFQRNKHISSVHGMTLKEFKCDLCPRVFNLSGKLRVHFRTVHLKMKRYTCEVCDWKFYSKSEL 524          
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|914573733|gb|KOB76193.1| (Uncharacterized protein OBRU01_06181, partial [Operophtera brumata])

HSP 1 Score: 184.496 bits (467), Expect = 1.599e-50
Identity = 84/187 (44.92%), Postives = 125/187 (66.84%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNND-GVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            L +HL  KHQK ID  +D G+LP+KI  ++Y CV+C+ K+ +++ LN H+N HY  FIC+ CG+GF +  RLR H  +H+ G+ PCE C KVF     K+ H   +H+  K+++C  C E F+NY+Q+ +H+   HG+K + FKC LCPK+F+ SG LR H RY H+K + +ACE+CE++ +    L
Sbjct: 5406 LLTHLFEKHQKKIDPKSDVGILPFKINLDDYKCVICDKKYGEYKSLNHHMNVHYQNFICELCGSGFITPERLRVHCFTHETGSIPCEACDKVFRSKNAKKEHYAYIHMKVKRHRCPQCPETFRNYFQRSKHISLIHGMKTKEFKCDLCPKVFTVSGKLRVHVRYAHLKLKRYACEVCEWKFYSSSEL 5592          

HSP 2 Score: 169.088 bits (427), Expect = 4.400e-45
Identity = 77/187 (41.18%), Postives = 115/187 (61.50%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNND-GVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            L  HL  KH K IDLN + G+LPYK+  ++YIC +C  KF  ++ LN H+N HY +F+C+QCG+GF +  RL+ HV +H+ G++PC  C KVF      + H   +H+  KK+ C  C E F NY+Q+ +HL   HG+ +  +KC+ C ++F+  G LR H R +H+K +  AC+ C+     K  L
Sbjct: 3671 LVKHLFEKHNKKIDLNAEIGILPYKMNLDDYICAICGEKFTDYKTLNHHMNLHYPRFVCEQCGSGFVTAMRLKSHVVTHETGSFPCNACDKVFNSKDAMKGHFAYLHMKVKKHSCPQCHEKFSNYFQRLKHLSSVHGMDLDEYKCNFCTRVFNAKGPLRSHIRASHLKEKSHACDECDATFFSKSCL 3857          

HSP 3 Score: 163.696 bits (413), Expect = 3.448e-43
Identity = 79/188 (42.02%), Postives = 114/188 (60.64%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNND-GVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNK-CMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            L +HLI KH K IDLN D G+LP+KI  ++Y C +C+ K+  +  L+ H+N HY +F+C+QCG+GFA+  RL+ HV  H+ G++PC+ C KVFG    +  H    H+   K + C  C E F N  Q+  HL   HG+KM+  KC+ C K+F+  G L  H R  H+K +  AC++C+ Q   K  L
Sbjct: 4196 LLTHLIKKHNKEIDLNTDIGILPFKINLDDYKCAVCDEKYIDYNTLSHHMNVHYPRFVCEQCGSGFATAMRLKAHVLRHETGSFPCDACHKVFGSKNARNAHYVYTHIKKGKTRCCPQCPEKFSNVVQRLNHLSTIHGMKMKELKCNFCSKVFNLKGRLTLHVRSMHLKEKRHACDVCDAQFFGKSEL 4383          

HSP 4 Score: 162.155 bits (409), Expect = 1.189e-42
Identity = 76/187 (40.64%), Postives = 110/187 (58.82%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNND-GVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            L  HL+ KH K I  N D G+LP+K+  ++Y C +C+ KF  ++ LN H+N HY  F+C+QCG+GF +  RL+ HV +H+ G++PC  C KVF      + H + VH+  KK+ C  C E F  YYQK +H+   HG  +  F C+ CPK+F   G L  H R  H+K +  AC +C+   + K  L
Sbjct: 4819 LIKHLLEKHDKKIGPNPDIGILPFKMNLDDYKCAICDEKFTDYKTLNHHMNVHYPNFVCEQCGSGFVTAMRLKAHVVTHETGSFPCNACDKVFSSTDAMKGHYEYVHMKVKKHSCPQCSETFLLYYQKLKHITSVHGTNLEKFSCNYCPKVFIARGHLGRHVRETHLKEKRHACSVCDANFYGKSGL 5005          

HSP 5 Score: 161.77 bits (408), Expect = 1.322e-42
Identity = 73/177 (41.24%), Postives = 115/177 (64.97%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNND-GVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELC 176
            L +HLI KH+K I+  +D G++P+K T  +Y C +C+ ++ ++  L  H+N HY  FIC+QCG+GF +  RLR H  SH+ G+  C+ C K+F     K++H ++VH+  K++ C  C E F +YYQ+ +H+   HG+K++ FKC LC K+F  SG L  H R  H+K + +AC++C
Sbjct: 5092 LITHLIEKHKKKIEPKSDMGIIPFKFTLEDYKCTICDKRYAEYITLKHHMNIHYPNFICEQCGSGFVTAGRLRVHSFSHETGSIACDSCDKIFRSNNAKRMHNESVHMKLKRHSCPQCPETFLHYYQRLKHISSIHGMKLKEFKCDLCAKVFIASGKLYAHVRATHLKEKRYACDVC 5268          

HSP 6 Score: 160.614 bits (405), Expect = 3.579e-42
Identity = 77/187 (41.18%), Postives = 113/187 (60.43%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNND-GVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            L +HL  KH K ID N D G+LP+KI  + Y C +C+  +  F+ LN H+N HY K++C++CG+GF +  RL++HV SH+ G++PC  C KVFG     + H +  H+  KK+ C  C E F N+ Q+ +HL   HG K++ FKC+ C K+F+  G L  H R  H+K +   C LC+ +   K  L
Sbjct: 4506 LITHLYEKHNKKIDPNLDIGILPFKINLDNYKCAICDGNYTDFKTLNHHMNVHYPKYVCEKCGSGFVTAMRLKKHVVSHETGSFPCSACDKVFGSKDAMKGHYEYGHMKLKKHSCPQCPEKFLNHSQRLKHLTSIHGAKLKEFKCNFCSKVFNLRGRLSSHVRATHLKEKHHLCNLCDAKFFGKACL 4692          

HSP 7 Score: 157.147 bits (396), Expect = 6.636e-41
Identity = 73/178 (41.01%), Postives = 109/178 (61.24%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDL-NNDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCE 177
            LK+HL+ KH+    L ++DGVLP+ +    + C  C+  F ++  L  H+  H+  + C+QCG GF SE+ LRRH  +H+ G++ C EC KVF    +K  H + VHL AK+N+C YC E F  Y+QK  H+  AHGI ++ F C +CP +F+  G L  H R  H+K + +AC+ C+
Sbjct: 2784 LKNHLVNKHEHNSKLISDDGVLPFILDPGSFKCGSCDEGFPEYRTLTHHLKTHFQNYTCEQCGTGFVSESALRRHFGTHETGSFSCNECDKVFRTKESKLHHEKIVHLKAKRNRCPYCLETFLYYFQKLNHIATAHGIIVKQFTCDMCPSVFNIRGKLNSHIRTTHLKEKRYACDDCD 2961          

HSP 8 Score: 155.606 bits (392), Expect = 1.779e-40
Identity = 73/178 (41.01%), Postives = 109/178 (61.24%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDL-NNDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCE 177
            LK HL+  H+   +L ++DG+LP+K+    + C  C+  F ++  L  H+  H+  + C+QCG GF SE+ LRRH  +H+ G++PC EC KVF    +K +H + VHL AK N+C YC E F  Y QK  H+   HGIK++ F C +CP +F+  G L  H R  H+K + +AC+ C+
Sbjct: 3124 LKHHLVNTHEHNSNLISDDGILPFKLEPGSFKCGSCDEGFPEYRTLFYHLKTHFQNYTCEQCGTGFVSESGLRRHFATHETGSFPCNECDKVFRTKQSKLLHEKIVHLKAKTNRCPYCFESFLYYDQKLNHISAVHGIKIKQFTCDMCPSVFNIRGRLYRHIRTTHLKEKRYACDDCD 3301          

HSP 9 Score: 150.214 bits (378), Expect = 1.365e-38
Identity = 71/178 (39.89%), Postives = 107/178 (60.11%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDL-NNDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCE 177
            LK HL+ KH+   +L ++D +LP+K+    + C  C+  F ++  L  H+  H+  + C+QCG G+ S   L+RHV SH+ G++PC EC KVF     K  H + VHL  K+N+C YC E F  Y QK  H+  AHGI ++ F+C +CP +F+  G L  H R  H+K +  AC++C+
Sbjct: 2470 LKIHLVNKHKLNSNLISHDRILPFKLDTGSFKCGTCDEGFPEYMTLFHHLKTHFQNYTCEQCGTGYVSRIALQRHVASHQTGSFPCNECDKVFRTQQYKHNHEKMVHLKVKRNRCPYCLETFLYYVQKLNHIATAHGIIVKQFRCDMCPSVFNVKGELNSHIRTIHLKEKRHACDVCD 2647          

HSP 10 Score: 131.339 bits (329), Expect = 6.182e-32
Identity = 63/177 (35.59%), Postives = 98/177 (55.37%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELC 176
             K HL+  H K +D    D VLPYK+ + E+ C +C  ++E F  L++H+N+HY  +IC+ CG  FA+  R+  H  +H+ G +PC+ C + F    +   HI  VH   K+ KC  C+E F +Y  + +HL   HG K  IF C +CP++F        H R+ H++ +   C +C
Sbjct: 2121 FKIHLMAAHGKIVDCTWGDSVLPYKLGKEEHSCQICGKRYEMFLSLHKHMNEHYEHYICETCGKRFATAQRMVNHTRTHERGVFPCKRCEESFTSYASVYAHIAKVHRLNKRYKCPICDEKFVSYKHRLKHLNTVHGEKTAIFPCPVCPRVFDLCSQRTAHIRFRHLQERNHICSVC 2297          

HSP 11 Score: 120.168 bits (300), Expect = 4.415e-28
Identity = 64/180 (35.56%), Postives = 99/180 (55.00%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKIT--ENE-YICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELC 176
            LK HL   H K ID    D ++PY +T   NE Y CV+CE  F +  +L  H++ H++ + C+ CG+GF +   L++H+E H+ G +PC+ C KVF     + +H++ VHL     +C  C E F + Y++  HL DAH    R+ KC  C + F     L  H R  H++ +   C++C
Sbjct: 5807 LKRHLREAHDKAIDTELQDNLIPYDLTIHSNEGYQCVVCEQNFIKVRILVIHMSDHFSNYSCEVCGSGFMTLRLLKKHLEVHETGNFPCDRCEKVFSTTHKRALHVRGVHLKQYPRRCPMCPERFNSNYKRTIHLQDAHNQSTRVHKCKTCGRGFHLKYHLISHVRSVHLQERNQQCDVC 5986          

HSP 12 Score: 115.931 bits (289), Expect = 1.510e-26
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGS 156
            LK+HL   H   I+ + +DGV+P+++T  E+ CV CE++F++F  L  H+NKHY  F+CD CG  +++E +LR H   H+ G + C +C  VF     K  HI   H    + +C  C+E   +Y+ +  HL   HG +   ++C+ CP +F+   S
Sbjct: 1230 LKTHLNDDHAITINPSHSDGVIPFRLTGQEFRCVRCESRFDKFMTLFIHMNKHYPSFVCDSCGKAYSAENKLRSHKAIHESGRFECTQCDLVFSNRIAKNRHISEKHRPKDRYRCPICDEHLNSYHSRLLHLKMVHG-ESSEYRCTYCPAVFNSGSS 1385          

HSP 13 Score: 115.546 bits (288), Expect = 1.695e-26
Identity = 58/163 (35.58%), Postives = 83/163 (50.92%), Query Frame = 0
Query:   18 DGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQ-VFACELCEYQ 179
            DGVLP+ + +  + CV+CE KF  F  L  H+N HY  +IC  CG G+ +  RLR+H E H  G++ C +C +VF     +  H  T H    + +C +C   F +YY +  HL +AH  K  ++ C+ C   F  SG    H R  H   Q    C  C +Q
Sbjct:  624 DGVLPFYLDKESWKCVICEEKFNNFLKLYEHMNVHYQHYICATCGKGYMTAPRLRKHSEVHISGSFSCTDCDRVFVMRAARDSHKATAHAKGSRYECPHCYIRFDSYYHRMAHLKEAHCEKEVVYNCAHCDMTFKTSGKRASHVRSVHFPVQHDINCSYCGWQ 786          

HSP 14 Score: 114.775 bits (286), Expect = 3.330e-26
Identity = 63/178 (35.39%), Postives = 95/178 (53.37%), Query Frame = 0
Query:    1 LKSHLIGKHQKPI--DLNNDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELC 176
            LK HLI  H K I  D   D ++P+++    + C +C  ++ +   L  H++KH+  F C+ CG+ F S+  LRRH+E H+ G +PCE+C KVF   T K +HI+ VHL     +C  C E F + Y + +HL   HG    + KC  C K +     L+ H R  H + +   C +C
Sbjct: 6207 LKIHLIN-HAKDIEADTTQDNIIPFRLGYEPFQCQICGDEYLKLRQLIIHMSKHFNNFSCEVCGSVFISKKSLRRHLEIHETGTFPCEKCDKVFSNSTKKALHIRGVHLKHFPRRCPICPERFNSDYMRTKHLRMVHGRTTALNKCMACGKEYDLKYQLQLHIRSVHYQEKNQECPVC 6383          

HSP 15 Score: 112.849 bits (281), Expect = 1.375e-25
Identity = 55/172 (31.98%), Postives = 90/172 (52.33%), Query Frame = 0
Query:    6 IGKHQKPIDLN-NDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELC 176
            + +H+  +D    + VLPYK+ + E+ C +C  ++E F  L++H+N+H+  +IC+ CG  FA+  R+  H  +H  G +PC  C + F   +    H+  VH   K+ KC  C E F +Y  + +HL   HG    IF C  C K+F+       H R  H++ +   C+ C
Sbjct: 1797 LKEHENGLDFTWGESVLPYKLNKEEHTCQVCGKRYELFLSLHKHMNEHFEHYICETCGKRFATSQRMLTHARTHVRGVFPCRRCEETFESSSALYNHVSKVHRMNKRYKCPICNEKFVSYKHRLKHLSSVHGQNTAIFPCPSCTKVFTLCSQRSAHVRCQHLQERNHICQEC 1968          

HSP 16 Score: 110.538 bits (275), Expect = 1.159e-24
Identity = 64/186 (34.41%), Postives = 98/186 (52.69%), Query Frame = 0
Query:    1 LKSHLIGKHQKP-IDLNNDGVLPYK-ITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGA---YPCEECGKVFGKITTKQVHIQTVHLNAK--KNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQ 179
            L  HL   HQKP I++   GV+PY  I++ +Y C  C   F+ F  LN H+N HY   +C  CG  F+   ++  H+++H +GA   Y C +C +VF     +  H  +   ++   + +C +C E FK+Y  + +HL D H  K+  + CSLC  +F  +     H R  HIK + F C +C YQ
Sbjct: 1480 LVEHLKNAHQKPLINVLGLGVIPYLLISDGDYQCTHCTDTFKLFTTLNNHMNDHYPNSVCPLCGKAFSDSNKMTAHMKTHGIGAKGQYKCSKCDEVFPSAYDRHKHAMSSKHSSTMMRYRCPHCNENFKSYSNRLKHLKDFHDSKIE-YPCSLCSAVFRMTNQRTKHIRQVHIKDKRFNCTVCPYQ 1664          

HSP 17 Score: 95.1301 bits (235), Expect = 2.257e-19
Identity = 54/178 (30.34%), Postives = 81/178 (45.51%), Query Frame = 0
Query:   17 NDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVES------HKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIK--------MRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQS 180
            +DGVLP+K+ +  + C LC + F  F  +N H+N HY  ++CD CG GF S +R R H  S       +  ++ C  C  VF     +  H   VH    +  C  C E+F +Y  +  HL++ H  +        ++ + C++C K FS S     H R  H          C Y S
Sbjct:  948 SDGVLPFKLDDGGFFCQLCTSHFLTFTKINEHMNTHYQNYVCDTCGKGFVSTSRFRAHAHSVFNVYLPEKRSFTCGICDDVFCSKALRTSHRLKVHRKGIRYNCPRCSEVFTSYRARSNHLVNFHAQQSKERRSQILQTYVCNICDKSFSTSSKRSAHCRLVHNSPPRLESHQCYYCS 1125          

HSP 18 Score: 88.5817 bits (218), Expect = 4.521e-17
Identity = 62/183 (33.88%), Postives = 93/183 (50.82%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNNDGVLPY--KITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHV-ESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKK---NKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCE 177
            +K HL   H       ++G+  Y  K+    ++C LC   F  F LLN+H+N H  K IC++CG  F ++  L +H  ESH    + C+ C + F K +  + H Q +H   ++   NKC  C + FK +Y K  HL +AHG+  + F+C LC   FS   SL  H   +H +     CE+C 
Sbjct: 6878 IKEHLQAAHAICFFTVSNGITEYNLKLKNKMFVCQLCNKSFHNFSLLNKHMNCHVGKVICEKCGDRFLNQHLLMKHYKESHLYKHFSCKLCDRYFTKRSQLKYHTQ-IHKGKQRTNLNKCPECLKTFKQHYGKMLHLKEAHGV-TKSFECHLCELKFSMRRSLTEHVSKDHTEKH--KCEVCS 7056          

HSP 19 Score: 87.0409 bits (214), Expect = 1.289e-16
Identity = 48/145 (33.10%), Postives = 83/145 (57.24%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNND-GVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVE------SHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIK 138
            L +HLI KH K IDLN D G+LP+KI  ++Y C +C+ K+  +  L+ H+N HY +F+C+QCG+GFA+  RL+ H +      + +       EC ++F     KQ  +  +        C+YC++ +K+  + ++H ++   +K
Sbjct: 4024 LLTHLIKKHNKEIDLNTDIGILPFKINLDDYKCAVCDEKYIDYNTLSHHMNVHYPRFVCEQCGSGFATAMRLKAHTQVTLDNHAKRKHILVLLECSRIF---LFKQKGVLFM--------CIYCDKKYKDPAKLREHNIEHEDVK 4157          

HSP 20 Score: 87.0409 bits (214), Expect = 1.639e-16
Identity = 47/157 (29.94%), Postives = 80/157 (50.96%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKITE-NEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEE--LFKNYYQKQQHLLDAHGIK--MRIFKCSLCPKIF 151
            L  HL   H++PI  +   GVLP+K+ + + + C +C  +F  F  L +H ++HY  ++CD CG GF ++  L  H        Y C  C   F  +  + +HI+T H       C+YC+E   F  +  +++HL++ H  K    +++C+ C   F
Sbjct:  302 LMVHLKSDHKQPISTDVQPGVLPFKLKDGSSWQCAICTIQFSDFISLKKHTSEHYQNYVCDTCGEGFITDTALIAHTRIPHDNKYACGRCVATFSTLEERSIHIKTQHTTLPY-MCIYCKENPRFATWELRKRHLMEFHNYKPGADMYECTTCHMTF 457          

HSP 21 Score: 86.6557 bits (213), Expect = 2.084e-16
Identity = 56/183 (30.60%), Postives = 87/183 (47.54%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNNDGVLPYKITENEYI--CVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVH--LNAKKN---KCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELC 176
            ++ HL   H K  +   +G++ Y ++    +  C  C   F  F LLN+H+N H++  +C+ CG GF S  RL  H   H++G + C++C +VF      + H    H   N KK    KC +C E F  +Y+K  HL   HGI    F C +C  +     +L   E    +  Q   C++C
Sbjct: 6530 IRKHLTAAHNKEFNSAGNGLMAYDLSSTNGMLSCHKCAKSFNSFFLLNQHMNVHFS-VVCETCGLGFMSHQRLVNHKIVHQIGVHKCDKCQEVFPNKLKLRYHTFKKHEVTNMKKIKPLKCPHCLERFSEHYRKMTHLKQIHGISFN-FDCQVCKAVLPTRRALT--EHTTKLHTQRIQCKIC 6708          

HSP 22 Score: 75.485 bits (184), Expect = 1.547e-12
Identity = 35/75 (46.67%), Postives = 52/75 (69.33%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNND-GVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRH 74
            LK+HL+ KH++  +L  D G+LP+K+    Y C +C  +F ++  L+RH NKH+  +IC+ CGAGFAS+ RLR H
Sbjct: 3479 LKNHLVYKHKQSSNLIKDAGILPFKLQHGSYKCGICFEEFTKYMNLSRHFNKHFQNYICELCGAGFASQPRLRTH 3553          
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|930673783|gb|KPJ14216.1| (Zinc finger protein 729 [Papilio machaon])

HSP 1 Score: 183.726 bits (465), Expect = 2.973e-50
Identity = 81/186 (43.55%), Postives = 126/186 (67.74%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLNNDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            LK HL+ +H   I+ +NDG+LP+KI+++ ++C+LC  KFE F+ LN H+N H+  +IC+QCG+GF +  RLR H   H  G++PCEEC KVF   T +  HI  +H   K+++C  C E F+NY+Q+ +H+   HG+ ++ FKC LCP++F+ SG LR H R  H+K + + CE+C+++ + K  L
Sbjct:  480 LKYHLMDRHDMYIN-SNDGILPFKISKDNFVCILCSTKFETFKSLNHHMNVHFQNYICEQCGSGFITPDRLRAHSVIHVNGSFPCEECHKVFRSNTARTEHIANIHKKCKRHRCPECHEGFRNYFQRNKHISSVHGMTLKEFKCDLCPRVFNLSGKLRVHFRTVHLKMKRYTCEVCDWKFYSKSEL 664          

HSP 2 Score: 130.568 bits (327), Expect = 9.000e-32
Identity = 63/177 (35.59%), Postives = 102/177 (57.63%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELC 176
            LKSHL  +H K +D +  D +LPY +T++++ C +C  ++E F  L++H+N+HY  FIC+ CG  FA+  R+  H  +H+ G +PC+ C   F    +   H+  +H + K+ KC  C+E F +Y  + +HL   HG K  IF C  CP++F        H R+ H++ +  +C LC
Sbjct:  106 LKSHL-REHGKHLDCSYGDSILPYNLTKDDHRCQICGKRYEMFLSLHKHMNEHYEHFICETCGKRFATSQRMVNHARTHERGDFPCKRCQDTFPSYASLYAHVAKIHRSNKRYKCPICDEKFASYKHRLKHLNTIHGEKTAIFPCPSCPRVFDLCSRRTAHIRFQHLQERNHSCPLC 281          

HSP 3 Score: 116.316 bits (290), Expect = 9.306e-27
Identity = 64/189 (33.86%), Postives = 105/189 (55.56%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKITENE--YICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            LK HL  +H K I+ +  D ++P+ +  +E  Y CV+CE+KF +   L  H++ H+  + C+ CG+GF +   L++H+E H+ G + C+ C KVF       +HI+ VHL     +C  C E F + Y++ +HL D H    R+ KC  C + F+    L CH R  H++ +   C++C  +  +K TL
Sbjct:  891 LKVHLKVEHHKLIEPDLKDNIIPFVLEGDEEGYKCVMCESKFIKVRTLVIHMSVHFNNYSCEICGSGFMTLRLLKKHLEVHESGNFHCDRCNKVFNTSHKLSLHIRGVHLKQYPRRCPICPERFNSNYRRTKHLQDVHNQSTRVHKCKTCGRGFNLRYHLVCHTRSVHLQERNHQCKICLQRFCNKETL 1079          
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|1073543067|gb|JAT88645.1| (hypothetical protein g.1890, partial [Pectinophora gossypiella])

HSP 1 Score: 166.007 bits (419), Expect = 9.379e-49
Identity = 76/180 (42.22%), Postives = 116/180 (64.44%), Query Frame = 0
Query:    8 KHQKPIDLNND-GVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            KH K +DLN+  GVLP+K++++ + C LC  +F++F  LN H+N H+  +IC+ CGAGF +  RLR H  SH+ G++PC+ C KVF     +  H  TVH   ++++C +C E FKNYYQ+ +H+   HG+K++ FKC  C K+F  SG L  H+R  H K + + C+ CE++ + K  L
Sbjct:    2 KHNKLLDLNSSCGVLPFKLSKSNFNCALCSKEFDEFTSLNHHMNVHFQNYICELCGAGFITPDRLRTHSYSHQTGSFPCDGCSKVFRSANARNEHYDTVHRKVQRHRCPHCVETFKNYYQRNKHISTVHGLKIKEFKCQTCLKVFQSSGKLGVHKRMVHEKLKRYQCDACEWKFYSKFEL 181          
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|768414096|ref|XP_011569196.1| (PREDICTED: zinc finger protein 613-like isoform X3 [Plutella xylostella])

HSP 1 Score: 157.147 bits (396), Expect = 2.594e-41
Identity = 70/187 (37.43%), Postives = 113/187 (60.43%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL 186
            +K HL+  H + ++L   DG+LP+K+   ++ C LC++ F  ++ LN+H+N H+  +IC+ CGAGF S +RLR H  SH     PCE C K F     ++ H   VH+  K+++C +C E F+NY+Q+ +H+   H +K++ +KC  C K+F  SG L  H    H+K +  +CE CE++ + K  L
Sbjct:  441 VKFHLVASHSQNLNLEIPDGILPFKLFSGDFKCALCDSDFTDYKTLNQHMNTHFQNYICELCGAGFVSPSRLRSHYFSHGTEKVPCEVCKKYFKSENARKEHHANVHMKVKRHRCPHCPEAFRNYFQRNKHITSVHNLKVKEYKCKYCDKVFKNSGKLPTHINTVHLKLKRHSCEFCEWKFYSKSEL 627          
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|512908522|ref|XP_004926702.1| (PREDICTED: zinc finger protein 260-like isoform X2 [Bombyx mori])

HSP 1 Score: 154.836 bits (390), Expect = 5.069e-41
Identity = 71/180 (39.44%), Postives = 112/180 (62.22%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQ 179
            LKSHL   H+K I    +D V+PYK++ + + C  C   FE F  + RH+N H+  ++C +CGAGF ++ RL+ HV+ H  G +PCE CGK+F      + H+ TVH   K+ KC  C E F  Y+++Q+H+++ HG+    ++C++C KIF R  +L  H + +H++ + F CELC Y+
Sbjct:  317 LKSHLSKVHEKKIYTEFSDKVVPYKLSRDNFECQFCGCNFETFGAIERHMNVHFRNYVCKECGAGFVTKYRLKVHVKGHSDGVFPCEMCGKIFTTQQKHKNHVDTVHKMVKRFKCTQCPERFTEYFRRQRHMVEVHGVAPLQYRCNVCDKIFERRYTLSRHMKRDHLEERDFQCELCSYK 496          
BLAST of OSCA025890-RA vs. genbank:protein
Match: gi|512908518|ref|XP_004926701.1| (PREDICTED: zinc finger protein 260-like isoform X1 [Bombyx mori])

HSP 1 Score: 154.836 bits (390), Expect = 5.294e-41
Identity = 71/180 (39.44%), Postives = 112/180 (62.22%), Query Frame = 0
Query:    1 LKSHLIGKHQKPIDLN-NDGVLPYKITENEYICVLCEAKFEQFELLNRHINKHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQVHIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKIFSRSGSLRCHERYNHIKAQVFACELCEYQ 179
            LKSHL   H+K I    +D V+PYK++ + + C  C   FE F  + RH+N H+  ++C +CGAGF ++ RL+ HV+ H  G +PCE CGK+F      + H+ TVH   K+ KC  C E F  Y+++Q+H+++ HG+    ++C++C KIF R  +L  H + +H++ + F CELC Y+
Sbjct:  319 LKSHLSKVHEKKIYTEFSDKVVPYKLSRDNFECQFCGCNFETFGAIERHMNVHFRNYVCKECGAGFVTKYRLKVHVKGHSDGVFPCEMCGKIFTTQQKHKNHVDTVHKMVKRFKCTQCPERFTEYFRRQRHMVEVHGVAPLQYRCNVCDKIFERRYTLSRHMKRDHLEERDFQCELCSYK 498          
The following BLAST results are available for this feature:
BLAST of OSCA025890-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|943953443|ref|XP_014359615.1|2.350e-5343.55PREDICTED: zinc finger protein 28-like [Papilio ma... [more]
gi|357631483|gb|EHJ78956.1|2.695e-5345.45hypothetical protein KGM_06924 [Danaus plexippus][more]
gi|827548047|ref|XP_012546282.1|4.840e-5341.71PREDICTED: gastrula zinc finger protein XlCGF26.1-... [more]
gi|910311361|ref|XP_013163599.1|7.991e-5243.55PREDICTED: zinc finger protein 675 isoform X4 [Pap... [more]
gi|914573733|gb|KOB76193.1|1.599e-5044.92Uncharacterized protein OBRU01_06181, partial [Ope... [more]
gi|930673783|gb|KPJ14216.1|2.973e-5043.55Zinc finger protein 729 [Papilio machaon][more]
gi|1073543067|gb|JAT88645.1|9.379e-4942.22hypothetical protein g.1890, partial [Pectinophora... [more]
gi|768414096|ref|XP_011569196.1|2.594e-4137.43PREDICTED: zinc finger protein 613-like isoform X3... [more]
gi|512908522|ref|XP_004926702.1|5.069e-4139.44PREDICTED: zinc finger protein 260-like isoform X2... [more]
gi|512908518|ref|XP_004926701.1|5.294e-4139.44PREDICTED: zinc finger protein 260-like isoform X1... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005488 binding
molecular_function GO:0046872 metal ion binding
molecular_function GO:0003676 nucleic acid binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015880Zinc finger, C2H2-likeSMARTSM00355ZnF_C2H2coord: 30..52
e-value: 0.17
score: 21.0
coord: 83..106
e-value: 0.021
score: 24.0
coord: 112..135
e-value: 3.9
score: 16.5
coord: 142..165
e-value: 0.044
score: 22.9
coord: 56..78
e-value: 0.0032
score: 26.7
IPR007087Zinc finger, C2H2PFAMPF00096zf-C2H2coord: 83..106
e-value: 0.023
score: 14.9
coord: 142..165
e-value: 0.005
score: 16.9
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 58..78
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 114..135
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 144..165
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 32..52
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 85..106
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 83..111
score: 11.323
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 142..170
score: 10.928
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 56..78
score: 10.741
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 60..78
e-value: 9.7E-4
score: 18.2
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 140..162
e-value: 9.9E-5
score: 21.6
NoneNo IPR availablePFAMPF13894zf-C2H2_4coord: 56..78
e-value: 3.5E-4
score: 20.6
coord: 30..52
e-value: 0.0018
score: 18.3
NoneNo IPR availablePANTHERPTHR24375:SF106HERMAPHRODITE-RELATEDcoord: 27..179
NoneNo IPR availablePANTHERPTHR24375FAMILY NOT NAMEDcoord: 27..179
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 82..121
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 55..92
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 27..66
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 121..177
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3D3.30.40.10coord: 25..59
e-value: 3.3E-4
score: 19.6

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_23510contignewscf_23510:3..560 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025890-RAOSCA025890-RAOstrinia scapulalismRNAnewscf_23510 3..560 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025890-PA ID=OSCA025890-PA|Name=OSCA025890-RA|organism=Ostrinia scapulalis|type=polypeptide|length=186bp
LKSHLIGKHQKPIDLNNDGVLPYKITENEYICVLCEAKFEQFELLNRHIN
KHYTKFICDQCGAGFASEARLRRHVESHKVGAYPCEECGKVFGKITTKQV
HIQTVHLNAKKNKCMYCEELFKNYYQKQQHLLDAHGIKMRIFKCSLCPKI
FSRSGSLRCHERYNHIKAQVFACELCEYQSHDKGTL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005488binding
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR013087Znf_C2H2/integrase_DNA-bd
IPR007087Znf_C2H2
IPR015880Znf_C2H2-like