OSCA025892-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025892-RA
Unique NameOSCA025892-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length57
Homology
BLAST of OSCA025892-RA vs. genbank:protein
Match: gi|930652464|gb|KPI94803.1| (hypothetical protein RR46_11807 [Papilio xuthus])

HSP 1 Score: 111.309 bits (277), Expect = 2.552e-30
Identity = 51/54 (94.44%), Postives = 54/54 (100.00%), Query Frame = 0
Query:    1 GPPCLPCGMDPVTVRRPLIVHDSTFDYRPTSWPGMLLNNQDKKVRYQLINYERP 54
            GPPCLPCGMDPVT+RRPLIVHDSTFDYRPTSWPGM+LNNQDKKVRYQLINY+RP
Sbjct:   25 GPPCLPCGMDPVTLRRPLIVHDSTFDYRPTSWPGMVLNNQDKKVRYQLINYDRP 78          
BLAST of OSCA025892-RA vs. genbank:protein
Match: gi|930676545|gb|KPJ16685.1| (hypothetical protein RR48_10284 [Papilio machaon])

HSP 1 Score: 109.383 bits (272), Expect = 8.264e-29
Identity = 49/54 (90.74%), Postives = 54/54 (100.00%), Query Frame = 0
Query:    1 GPPCLPCGMDPVTVRRPLIVHDSTFDYRPTSWPGMLLNNQDKKVRYQLINYERP 54
            GPPCLPCG+DPVT+RRPLIV+DSTFDYRPTSWPGM+LNNQDKKVRYQLINY+RP
Sbjct:   25 GPPCLPCGIDPVTLRRPLIVNDSTFDYRPTSWPGMVLNNQDKKVRYQLINYDRP 78          
BLAST of OSCA025892-RA vs. genbank:protein
Match: gi|357620064|gb|EHJ72387.1| (hypothetical protein KGM_15284 [Danaus plexippus])

HSP 1 Score: 102.834 bits (255), Expect = 8.791e-27
Identity = 47/55 (85.45%), Postives = 52/55 (94.55%), Query Frame = 0
Query:    1 GPPCLPCGMDPVTVRRPLIVHDSTFDYRPTSWPGMLLNNQDKKVRYQLINYERPV 55
            G  CLPCG+DPVT+RRPLIV DSTFDYRPTSWPGM++NNQDKKVRYQLINYERP+
Sbjct:   25 GLKCLPCGIDPVTMRRPLIVGDSTFDYRPTSWPGMVVNNQDKKVRYQLINYERPM 79          
BLAST of OSCA025892-RA vs. genbank:protein
Match: gi|914573388|gb|KOB75946.1| (Carbonic anhydrase [Operophtera brumata])

HSP 1 Score: 96.6709 bits (239), Expect = 6.272e-25
Identity = 45/49 (91.84%), Postives = 47/49 (95.92%), Query Frame = 0
Query:    9 MDPVTVRRPLIVHDSTFDYRPTSWPGMLLNNQDKKVRYQLINYERPVCL 57
            MDPVTVRRPLIV DSTFDYRPTSWPGMLLNNQ+KKVRYQLINYERPV +
Sbjct:    1 MDPVTVRRPLIVGDSTFDYRPTSWPGMLLNNQNKKVRYQLINYERPVSI 49          
The following BLAST results are available for this feature:
BLAST of OSCA025892-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 4
Match NameE-valueIdentityDescription
gi|930652464|gb|KPI94803.1|2.552e-3094.44hypothetical protein RR46_11807 [Papilio xuthus][more]
gi|930676545|gb|KPJ16685.1|8.264e-2990.74hypothetical protein RR48_10284 [Papilio machaon][more]
gi|357620064|gb|EHJ72387.1|8.791e-2785.45hypothetical protein KGM_15284 [Danaus plexippus][more]
gi|914573388|gb|KOB75946.1|6.272e-2591.84Carbonic anhydrase [Operophtera brumata][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_49595contignewscf_49595:398..571 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025892-RAOSCA025892-RAOstrinia scapulalismRNAnewscf_49595 398..571 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025892-PA ID=OSCA025892-PA|Name=OSCA025892-RA|organism=Ostrinia scapulalis|type=polypeptide|length=57bp
GPPCLPCGMDPVTVRRPLIVHDSTFDYRPTSWPGMLLNNQDKKVRYQLIN
YERPVCL
back to top