OSCA025893-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025893-RA
Unique NameOSCA025893-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length49
Homology
BLAST of OSCA025893-RA vs. genbank:protein
Match: gi|294566525|gb|ADF18553.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 61.6178 bits (148), Expect = 6.846e-10
Identity = 28/48 (58.33%), Postives = 34/48 (70.83%), Query Frame = 0
Query:    1 MEGRRARGRAPTRWSDAVRKTVGGSL-HAVHTAYDRSLWRNTICGRDP 47
            +EG+RA GR P RWSD  R+ +GGSL HAVH  +DR  W+   CGRDP
Sbjct:  941 IEGKRAVGRTPARWSDLAREALGGSLYHAVHATHDRVHWKYIACGRDP 988          
The following BLAST results are available for this feature:
BLAST of OSCA025893-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 1
Match NameE-valueIdentityDescription
gi|294566525|gb|ADF18553.1|6.846e-1058.33endonuclease-reverse transcriptase [Bombyx mori][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_12598contignewscf_12598:3546..3695 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025893-RAOSCA025893-RAOstrinia scapulalismRNAnewscf_12598 3546..3695 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025893-PA ID=OSCA025893-PA|Name=OSCA025893-RA|organism=Ostrinia scapulalis|type=polypeptide|length=49bp
MEGRRARGRAPTRWSDAVRKTVGGSLHAVHTAYDRSLWRNTICGRDPYQ
back to top