OSCA025894-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025894-RA
Unique NameOSCA025894-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length146
Homology
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|909555081|ref|XP_013149030.1| (PREDICTED: facilitated trehalose transporter Tret1-2 homolog [Papilio polytes])

HSP 1 Score: 184.882 bits (468), Expect = 1.914e-53
Identity = 87/146 (59.59%), Postives = 110/146 (75.34%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M + LGPVL+GEYTSP+NRGAFL TIS+TI  GVL VH LGSYL WQTAAL+   +T VDLLIVI SPESP+WLADQGR+E+   +FRWLRG++EE+EL++MI+TS  +R+ K D     +   K+ + I     T+K+ EFYKPI
Sbjct:  122 MSATLGPVLVGEYTSPRNRGAFLTTISLTIATGVLVVHTLGSYLAWQTAALVCAFITFVDLLIVIYSPESPSWLADQGRYEDSEKVFRWLRGESEEEELKRMIETSVIVRESKVDANVSQSFTSKVRSQITYISTTVKKKEFYKPI 267          
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|930664147|gb|KPJ05561.1| (Facilitated trehalose transporter Tret1-2-like [Papilio xuthus])

HSP 1 Score: 184.111 bits (466), Expect = 2.223e-53
Identity = 87/146 (59.59%), Postives = 109/146 (74.66%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M + LGPVLIGEYTSP+NRGAFL TIS+TI  GVL VH LGSYL WQTAAL+   +T VDLLIVI SPESP+WLADQGR+E+   +F+WLRG++E++EL +MI+TS  +R+ KAD     +   KM   I     T+++ EFYKPI
Sbjct:   99 MSATLGPVLIGEYTSPRNRGAFLTTISLTIATGVLVVHTLGSYLAWQTAALVCAFITFVDLLIVIYSPESPSWLADQGRYEDSEKVFKWLRGESEDEELRRMIETSIIVRESKADANISQSFTSKMKTQITYISTTVRKKEFYKPI 244          
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|910330683|ref|XP_013168647.1| (PREDICTED: facilitated trehalose transporter Tret1-2 homolog [Papilio xuthus])

HSP 1 Score: 184.111 bits (466), Expect = 4.107e-53
Identity = 87/146 (59.59%), Postives = 109/146 (74.66%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M + LGPVLIGEYTSP+NRGAFL TIS+TI  GVL VH LGSYL WQTAAL+   +T VDLLIVI SPESP+WLADQGR+E+   +F+WLRG++E++EL +MI+TS  +R+ KAD     +   KM   I     T+++ EFYKPI
Sbjct:  122 MSATLGPVLIGEYTSPRNRGAFLTTISLTIATGVLVVHTLGSYLAWQTAALVCAFITFVDLLIVIYSPESPSWLADQGRYEDSEKVFKWLRGESEDEELRRMIETSIIVRESKADANISQSFTSKMKTQITYISTTVRKKEFYKPI 267          
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|930677877|gb|KPJ17887.1| (Facilitated trehalose transporter Tret1-2-like [Papilio machaon])

HSP 1 Score: 182.956 bits (463), Expect = 6.107e-53
Identity = 87/146 (59.59%), Postives = 107/146 (73.29%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M + LGPVLIGEYTSP NRGAFL TIS+TI  GVL VH LGSYL WQTAAL+   +  VDLLIVI SPESP+WLADQGR+E+   +FRWLRG++E++EL +MI+TS  +R+ KAD     +   KM   I     T+++ EFYKPI
Sbjct:   99 MSATLGPVLIGEYTSPSNRGAFLTTISLTIATGVLVVHTLGSYLAWQTAALVCAFIVFVDLLIVIYSPESPSWLADQGRYEDSEKVFRWLRGESEDEELRRMIETSIIVRESKADANISQSFTSKMKTQITYISTTVRKKEFYKPI 244          
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|943942123|ref|XP_014354641.1| (PREDICTED: facilitated trehalose transporter Tret1-2 homolog [Papilio machaon])

HSP 1 Score: 182.57 bits (462), Expect = 1.514e-52
Identity = 87/146 (59.59%), Postives = 107/146 (73.29%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M + LGPVLIGEYTSP NRGAFL TIS+TI  GVL VH LGSYL WQTAAL+   +  VDLLIVI SPESP+WLADQGR+E+   +FRWLRG++E++EL +MI+TS  +R+ KAD     +   KM   I     T+++ EFYKPI
Sbjct:  122 MSATLGPVLIGEYTSPSNRGAFLTTISLTIATGVLVVHTLGSYLAWQTAALVCAFIVFVDLLIVIYSPESPSWLADQGRYEDSEKVFRWLRGESEDEELRRMIETSIIVRESKADANISQSFTSKMKTQITYISTTVRKKEFYKPI 267          
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|357617527|gb|EHJ70841.1| (sugar transporter protein [Danaus plexippus])

HSP 1 Score: 176.407 bits (446), Expect = 3.236e-50
Identity = 85/148 (57.43%), Postives = 109/148 (73.65%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALR--KEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M ++LGPVLIGEYTSPKNRGAFL  IS+TI  GVL VH LGSY  WQ  ALI+  +  +DLLIVI SPESP+WLADQG+++EC  +F+WLRGD E DELEKMI +S  +R  KE  +V+   +  V+  +N+    +T+++ EFYKPI
Sbjct:  123 MSASLGPVLIGEYTSPKNRGAFLAVISLTIATGVLFVHSLGSYFSWQKTALIIAILVFIDLLIVIYSPESPSWLADQGKYDECRKVFKWLRGDEENDELEKMIDSSKIVREAKELTNVSQSFSKTVR--SNLAYVNVTIRKKEFYKPI 268          
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|827546681|ref|XP_012545743.1| (PREDICTED: facilitated trehalose transporter Tret1-like [Bombyx mori])

HSP 1 Score: 172.17 bits (435), Expect = 1.191e-48
Identity = 86/146 (58.90%), Postives = 110/146 (75.34%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M ++LGPVLIGEYTSP NRGAFL +IS+TI  GVLAVH +GSYL WQT AL+   +  VDLLIVI SPESP+WLADQGR++EC  +FRWLR + EE+ELE+MI+ +  +R+ KADV    + L K+  N+  F  T+ + EFY+PI
Sbjct:  122 MSASLGPVLIGEYTSPNNRGAFLTSISLTIATGVLAVHTMGSYLSWQTTALVCAFIAFVDLLIVIYSPESPSWLADQGRYDECRKVFRWLRSEEEEEELERMIEAAIVVRESKADVNLSESFLNKVKRNVSHFCSTIMKREFYRPI 267          
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|512894733|ref|XP_004923500.1| (PREDICTED: facilitated trehalose transporter Tret1-like [Bombyx mori])

HSP 1 Score: 170.629 bits (431), Expect = 4.514e-48
Identity = 76/146 (52.05%), Postives = 108/146 (73.97%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M ++LG  LIGEY SP+NRG FLMTISI+I  GVL VH +GSYL W+T+A++  ++ ++DL+IVI SPESP+WLADQG+++EC  +FRWLRG  EE EL+ +I+ S  +R+ KA+       L K+ +N+  F+ T+ + EF+KPI
Sbjct:  124 MATSLGSTLIGEYASPRNRGVFLMTISISIAFGVLCVHAMGSYLDWKTSAIVCGSVALIDLVIVIFSPESPSWLADQGKYDECKKVFRWLRGTKEEQELKNLIEASIIVRESKAEANVRRTLLKKIKSNVVYFKTTITKKEFFKPI 269          
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|913329776|ref|XP_013196378.1| (PREDICTED: facilitated trehalose transporter Tret1-like isoform X2 [Amyelois transitella])

HSP 1 Score: 166.392 bits (420), Expect = 2.132e-46
Identity = 78/146 (53.42%), Postives = 104/146 (71.23%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M + L P+LIGEYTSP NRGAFL TIS+TI +GVL VH +GS+L WQT ALI   ++ VDLLIV++SPESP+WLAD+GR  +C  +FRWLRGD EE EL++MI+ +T +R+ +  V    +    +   I  F  T+ + EF+KPI
Sbjct:  121 MSATLSPILIGEYTSPSNRGAFLTTISLTIAIGVLTVHAMGSFLSWQTTALICAFISFVDLLIVMNSPESPSWLADRGRLTDCRRVFRWLRGDGEEAELKEMIEATTVVREARETVNVSQSFGQSVKAKIAYFSSTITKKEFFKPI 266          
BLAST of OSCA025894-RA vs. genbank:protein
Match: gi|913329774|ref|XP_013196377.1| (PREDICTED: facilitated trehalose transporter Tret1-2 homolog isoform X1 [Amyelois transitella])

HSP 1 Score: 166.392 bits (420), Expect = 8.976e-46
Identity = 78/146 (53.42%), Postives = 104/146 (71.23%), Query Frame = 0
Query:    1 MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAALIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELEKMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI 146
            M + L P+LIGEYTSP NRGAFL TIS+TI +GVL VH +GS+L WQT ALI   ++ VDLLIV++SPESP+WLAD+GR  +C  +FRWLRGD EE EL++MI+ +T +R+ +  V    +    +   I  F  T+ + EF+KPI
Sbjct:  225 MSATLSPILIGEYTSPSNRGAFLTTISLTIAIGVLTVHAMGSFLSWQTTALICAFISFVDLLIVMNSPESPSWLADRGRLTDCRRVFRWLRGDGEEAELKEMIEATTVVREARETVNVSQSFGQSVKAKIAYFSSTITKKEFFKPI 370          
The following BLAST results are available for this feature:
BLAST of OSCA025894-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909555081|ref|XP_013149030.1|1.914e-5359.59PREDICTED: facilitated trehalose transporter Tret1... [more]
gi|930664147|gb|KPJ05561.1|2.223e-5359.59Facilitated trehalose transporter Tret1-2-like [Pa... [more]
gi|910330683|ref|XP_013168647.1|4.107e-5359.59PREDICTED: facilitated trehalose transporter Tret1... [more]
gi|930677877|gb|KPJ17887.1|6.107e-5359.59Facilitated trehalose transporter Tret1-2-like [Pa... [more]
gi|943942123|ref|XP_014354641.1|1.514e-5259.59PREDICTED: facilitated trehalose transporter Tret1... [more]
gi|357617527|gb|EHJ70841.1|3.236e-5057.43sugar transporter protein [Danaus plexippus][more]
gi|827546681|ref|XP_012545743.1|1.191e-4858.90PREDICTED: facilitated trehalose transporter Tret1... [more]
gi|512894733|ref|XP_004923500.1|4.514e-4852.05PREDICTED: facilitated trehalose transporter Tret1... [more]
gi|913329776|ref|XP_013196378.1|2.132e-4653.42PREDICTED: facilitated trehalose transporter Tret1... [more]
gi|913329774|ref|XP_013196377.1|8.976e-4653.42PREDICTED: facilitated trehalose transporter Tret1... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055085 transmembrane transport
biological_process GO:0006810 transport
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0016020 membrane
molecular_function GO:0022857 transmembrane transporter activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005828General substrate transporterPFAMPF00083Sugar_trcoord: 2..123
e-value: 1.1E-8
score: 34.0
NoneNo IPR availablePANTHERPTHR24063FAMILY NOT NAMEDcoord: 1..114
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 46..65
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 41..45
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 66..146
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..20
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 21..40
NoneNo IPR availableTMHMMTMhelixcoord: 49..66
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
IPR020846Major facilitator superfamily domainSUPERFAMILY103473MFS general substrate transportercoord: 2..82

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_22828contignewscf_22828:3320..3757 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025894-RAOSCA025894-RAOstrinia scapulalismRNAnewscf_22828 3320..3757 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025894-PA ID=OSCA025894-PA|Name=OSCA025894-RA|organism=Ostrinia scapulalis|type=polypeptide|length=146bp
MVSALGPVLIGEYTSPKNRGAFLMTISITIGMGVLAVHVLGSYLRWQTAA
LIVIAMTVVDLLIVISSPESPAWLADQGRFEECTVIFRWLRGDTEEDELE
KMIKTSTALRKEKADVATEGACLVKMWNNIKDFRLTLKRNEFYKPI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: INTERPRO
TermDefinition
IPR020846MFS_dom
IPR005828Sub_transporter