OSCA025895-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025895-RA
Unique NameOSCA025895-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length83
Homology
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|910326068|ref|XP_013166172.1| (PREDICTED: rho guanine nucleotide exchange factor 17 [Papilio xuthus])

HSP 1 Score: 125.176 bits (313), Expect = 1.375e-31
Identity = 56/63 (88.89%), Postives = 59/63 (93.65%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYLQPLKSPENAGLLD+FVVDEIF Q+P I NVHQVFLEQLRRRLEQWDLQQKVGDVFLDV +
Sbjct:  727 KYLQPLKSPENAGLLDAFVVDEIFYQVPAILNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVFT 789          
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|930656465|gb|KPI98789.1| (Rho guanine nucleotide exchange factor 17 [Papilio xuthus])

HSP 1 Score: 123.635 bits (309), Expect = 4.409e-31
Identity = 56/63 (88.89%), Postives = 59/63 (93.65%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYLQPLKSPENAGLLD+FVVDEIF Q+P I NVHQVFLEQLRRRLEQWDLQQKVGDVFLDV +
Sbjct:   82 KYLQPLKSPENAGLLDAFVVDEIFYQVPAILNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVFT 144          
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|943954376|ref|XP_014360119.1| (PREDICTED: rho guanine nucleotide exchange factor 17-like isoform X1 [Papilio machaon])

HSP 1 Score: 123.25 bits (308), Expect = 6.381e-31
Identity = 55/63 (87.30%), Postives = 58/63 (92.06%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYL PLKSPENAGLLD+FVVDEIF Q+P I NVHQVFLEQLRRRLEQWDLQQKVGDVFLDV +
Sbjct:  727 KYLHPLKSPENAGLLDAFVVDEIFYQVPAILNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVFT 789          
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|943954378|ref|XP_014360120.1| (PREDICTED: rho guanine nucleotide exchange factor 17-like isoform X2 [Papilio machaon])

HSP 1 Score: 122.865 bits (307), Expect = 9.107e-31
Identity = 55/63 (87.30%), Postives = 58/63 (92.06%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYL PLKSPENAGLLD+FVVDEIF Q+P I NVHQVFLEQLRRRLEQWDLQQKVGDVFLDV +
Sbjct:  727 KYLHPLKSPENAGLLDAFVVDEIFYQVPAILNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVFT 789          
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|909568425|ref|XP_013139662.1| (PREDICTED: rho guanine nucleotide exchange factor 17 isoform X2 [Papilio polytes])

HSP 1 Score: 121.709 bits (304), Expect = 2.149e-30
Identity = 54/63 (85.71%), Postives = 58/63 (92.06%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYL PLKSPENAGLLD+FVVDEIF Q+P I NVHQVFLEQLRRRLEQWDLQQKVGDVFL+V +
Sbjct:  718 KYLHPLKSPENAGLLDAFVVDEIFYQVPAILNVHQVFLEQLRRRLEQWDLQQKVGDVFLEVFT 780          
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|930673374|gb|KPJ13904.1| (Rho guanine nucleotide exchange factor 17 [Papilio machaon])

HSP 1 Score: 121.709 bits (304), Expect = 2.233e-30
Identity = 55/63 (87.30%), Postives = 58/63 (92.06%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYL PLKSPENAGLLD+FVVDEIF Q+P I NVHQVFLEQLRRRLEQWDLQQKVGDVFLDV +
Sbjct:   82 KYLHPLKSPENAGLLDAFVVDEIFYQVPAILNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVFT 144          
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|909568423|ref|XP_013139661.1| (PREDICTED: rho guanine nucleotide exchange factor 17 isoform X1 [Papilio polytes])

HSP 1 Score: 121.709 bits (304), Expect = 2.278e-30
Identity = 54/63 (85.71%), Postives = 58/63 (92.06%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYL PLKSPENAGLLD+FVVDEIF Q+P I NVHQVFLEQLRRRLEQWDLQQKVGDVFL+V +
Sbjct:  727 KYLHPLKSPENAGLLDAFVVDEIFYQVPAILNVHQVFLEQLRRRLEQWDLQQKVGDVFLEVFT 789          
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|1073531325|gb|JAT82774.1| (hypothetical protein g.8161, partial [Pectinophora gossypiella])

HSP 1 Score: 119.783 bits (299), Expect = 1.187e-29
Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYLQPLKSPENAGLLD+F+VDEIF Q+P I NVHQVFLEQLRRRLEQWDLQQKVGDVFL+V +
Sbjct:  612 KYLQPLKSPENAGLLDAFLVDEIFYQVPGILNVHQVFLEQLRRRLEQWDLQQKVGDVFLEVFT 674          
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|768417719|ref|XP_011549510.1| (PREDICTED: rho guanine nucleotide exchange factor 17 [Plutella xylostella] >gi|768417721|ref|XP_011549512.1| PREDICTED: rho guanine nucleotide exchange factor 17 [Plutella xylostella])

HSP 1 Score: 119.398 bits (298), Expect = 1.486e-29
Identity = 54/63 (85.71%), Postives = 58/63 (92.06%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYLQPLKSPENA LLD+F VDEIF Q+P+I NVHQVFLEQLRRRLEQWDLQQKVGDVFLDV +
Sbjct:   84 KYLQPLKSPENAALLDAFTVDEIFYQVPSILNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVFT 146          
BLAST of OSCA025895-RA vs. genbank:protein
Match: gi|827558373|ref|XP_012550335.1| (PREDICTED: rho guanine nucleotide exchange factor 17 isoform X2 [Bombyx mori])

HSP 1 Score: 117.087 bits (292), Expect = 1.154e-28
Identity = 52/63 (82.54%), Postives = 58/63 (92.06%), Query Frame = 0
Query:    1 KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDLQQKVGDVFLDVVS 63
            KYLQPLKSPENA LLD+++VDEIF Q+P I NVHQVFLEQLRRRLEQWDLQQKVGDVFL+V +
Sbjct:  724 KYLQPLKSPENAALLDAYLVDEIFYQVPAILNVHQVFLEQLRRRLEQWDLQQKVGDVFLEVFT 786          
The following BLAST results are available for this feature:
BLAST of OSCA025895-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910326068|ref|XP_013166172.1|1.375e-3188.89PREDICTED: rho guanine nucleotide exchange factor ... [more]
gi|930656465|gb|KPI98789.1|4.409e-3188.89Rho guanine nucleotide exchange factor 17 [Papilio... [more]
gi|943954376|ref|XP_014360119.1|6.381e-3187.30PREDICTED: rho guanine nucleotide exchange factor ... [more]
gi|943954378|ref|XP_014360120.1|9.107e-3187.30PREDICTED: rho guanine nucleotide exchange factor ... [more]
gi|909568425|ref|XP_013139662.1|2.149e-3085.71PREDICTED: rho guanine nucleotide exchange factor ... [more]
gi|930673374|gb|KPJ13904.1|2.233e-3087.30Rho guanine nucleotide exchange factor 17 [Papilio... [more]
gi|909568423|ref|XP_013139661.1|2.278e-3085.71PREDICTED: rho guanine nucleotide exchange factor ... [more]
gi|1073531325|gb|JAT82774.1|1.187e-2985.71hypothetical protein g.8161, partial [Pectinophora... [more]
gi|768417719|ref|XP_011549510.1|1.486e-2985.71PREDICTED: rho guanine nucleotide exchange factor ... [more]
gi|827558373|ref|XP_012550335.1|1.154e-2882.54PREDICTED: rho guanine nucleotide exchange factor ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0043547 positive regulation of GTPase activity
biological_process GO:0035023 regulation of Rho protein signal transduction
molecular_function GO:0005089 Rho guanyl-nucleotide exchange factor activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 2..61
e-value: 4.8E-9
score: 36.2
IPR000219Dbl homology (DH) domainGENE3D1.20.900.10coord: 1..63
e-value: 3.5E-12
score: 45.7
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 1..60
score: 9.812
IPR000219Dbl homology (DH) domainSUPERFAMILY48065DBL homology domain (DH-domain)coord: 2..65
NoneNo IPR availablePANTHERPTHR12877:SF15RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 17coord: 1..63
NoneNo IPR availablePANTHERPTHR12877RHO GUANINE NUCLEOTIDE EXCHANGE FACTORcoord: 1..63

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_37385contignewscf_37385:801..1052 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025895-RAOSCA025895-RAOstrinia scapulalismRNAnewscf_37385 801..1052 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025895-PA ID=OSCA025895-PA|Name=OSCA025895-RA|organism=Ostrinia scapulalis|type=polypeptide|length=83bp
KYLQPLKSPENAGLLDSFVVDEIFNQIPTIFNVHQVFLEQLRRRLEQWDL
QQKVGDVFLDVVSLIDRETALVTRFSVDTQSWQ
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0035023regulation of Rho protein signal transduction
Vocabulary: Molecular Function
TermDefinition
GO:0005089Rho guanyl-nucleotide exchange factor activity
Vocabulary: INTERPRO
TermDefinition
IPR000219DH-domain