OSCA025896-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025896-RA
Unique NameOSCA025896-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length89
Homology
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|914572857|gb|KOB75589.1| (Alcohol dehydrogenase [Operophtera brumata])

HSP 1 Score: 92.4337 bits (228), Expect = 4.081e-21
Identity = 42/89 (47.19%), Postives = 61/89 (68.54%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            ME+ +KN VA++TGG+ GIG  I  +FL   AK V+++D  E +G   +  LN +YGDGK +F K DVT+DLD++ KK+ E Y  +D+L
Sbjct:    1 MERSLKNTVAVITGGAEGIGYEITAKFLEQQAKTVIVLDNNEEKGAAAVVDLNSKYGDGKAVFIKCDVTKDLDDVSKKIFETYSQVDVL 89          
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|943958872|ref|XP_014362108.1| (PREDICTED: alcohol dehydrogenase 1-like [Papilio machaon] >gi|930671688|gb|KPJ12400.1| Alcohol dehydrogenase 1 [Papilio machaon])

HSP 1 Score: 91.6633 bits (226), Expect = 9.162e-21
Identity = 43/89 (48.31%), Postives = 62/89 (69.66%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            M +E+KNK  +VTGGS GIG AI + FL   AK V+I++T E QG E   KL  +YG  K +++K DVT DL+ I+ K++E++ T+D+L
Sbjct:    1 MTRELKNKTIVVTGGSVGIGYAIADSFLQKNAKVVIILNTNEEQGTEAAIKLAAKYGQNKAVYYKCDVTTDLEVIFDKIIEEFTTVDVL 89          
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|509177969|gb|JAA87105.1| (Alcohol dehydrogenase [Pararge aegeria])

HSP 1 Score: 89.3521 bits (220), Expect = 6.831e-20
Identity = 39/89 (43.82%), Postives = 62/89 (69.66%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            M +++KNKV ++TGG+ GIG  I + +L  GAK  V++D  E QG+E  + L  ++G  K +F K DVTRDLD + +K+++ Y+T+D+L
Sbjct:    1 MARDLKNKVVVITGGAVGIGLEIADRYLQKGAKVAVLLDIAEGQGLEASKNLCAKHGANKAVFMKCDVTRDLDAVSRKIIDTYKTVDVL 89          
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|874594779|gb|AKQ06148.1| (alcohol dehydrogenase AD2 [Cydia pomonella])

HSP 1 Score: 88.1965 bits (217), Expect = 2.009e-19
Identity = 40/89 (44.94%), Postives = 62/89 (69.66%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            M K++KNK  ++TGG+ GIG  I + FL  GAK +VI+D  E QG E ++ LN ++G+ K +F K DVT DL+ + KK+++ Y+ +D+L
Sbjct:    1 MAKDLKNKTVVITGGAVGIGFEIADRFLQKGAKVIVILDINEKQGAEAVKTLNSKHGNNKAVFIKCDVTSDLEAVSKKIIDLYKHVDVL 89          
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|943958889|ref|XP_014362115.1| (PREDICTED: alcohol dehydrogenase-like [Papilio machaon] >gi|930671686|gb|KPJ12398.1| Alcohol dehydrogenase [Papilio machaon])

HSP 1 Score: 87.8113 bits (216), Expect = 2.383e-19
Identity = 39/89 (43.82%), Postives = 62/89 (69.66%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            M +E++NK  ++TGG+ GIG AI E FL    + V+I+D  E+ G E + KL ++YG  K +F+K DVT DL+ I+ K++E++ T+D+L
Sbjct:    1 MARELQNKTIVITGGAMGIGYAIAENFLQKNPRVVIILDINENLGNEAINKLAVKYGKNKAVFYKCDVTIDLEIIFDKIIEEFTTVDVL 89          
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|943958899|ref|XP_014362119.1| (PREDICTED: alcohol dehydrogenase 1-like [Papilio machaon] >gi|930671684|gb|KPJ12396.1| Alcohol dehydrogenase 1 [Papilio machaon])

HSP 1 Score: 87.8113 bits (216), Expect = 2.441e-19
Identity = 39/89 (43.82%), Postives = 63/89 (70.79%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            M +++KNK  +VTGGS GIG AI + FL    K V+I++T + QG E ++KL  +YG  K +++K DVT DL+ I+ K+++++ T+D+L
Sbjct:    1 MSRDLKNKTIVVTGGSVGIGYAIADSFLQKNPKVVIILNTNKEQGSEAIKKLAAKYGQNKAVYYKCDVTTDLELIFDKIIKEFNTVDVL 89          
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|768436712|ref|XP_011559858.1| (PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)]-like [Plutella xylostella] >gi|1127253084|gb|JAV02116.1| Aldehyde reductase5 [Plutella xylostella])

HSP 1 Score: 85.8853 bits (211), Expect = 1.539e-18
Identity = 36/88 (40.91%), Postives = 60/88 (68.18%), Query Frame = 0
Query:    2 EKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            E+ +KNKV ++TGG+ GIG  I + +L HGAK  +++D  E  G + ++ L  ++G  K +F K DVT D+D + KK+++ Y+T+D+L
Sbjct:    3 ERSLKNKVVVITGGATGIGLQIADNYLKHGAKLTILLDINEKHGADAVKTLTTKHGRNKAVFIKCDVTTDMDTVSKKILDTYKTVDVL 90          
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|930661799|gb|KPJ03686.1| (15-hydroxyprostaglandin dehydrogenase [NAD+] [Papilio xuthus])

HSP 1 Score: 83.9593 bits (206), Expect = 8.701e-18
Identity = 37/89 (41.57%), Postives = 60/89 (67.42%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            M K+++NK  ++TGG+ GIG AI E FL    K V+I+D  E  G + ++KL+ QYG+ K +F K +V  D++ I+ +++E Y T+D+L
Sbjct:    1 MTKDLQNKTIVITGGAVGIGYAIAESFLQKNPKVVIILDVNEDFGADAIKKLSAQYGEKKAVFLKCNVITDIEVIFNRIIEDYSTVDVL 89          
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|909581595|ref|XP_013146792.1| (PREDICTED: alcohol dehydrogenase-like [Papilio polytes])

HSP 1 Score: 83.5741 bits (205), Expect = 1.076e-17
Identity = 36/89 (40.45%), Postives = 61/89 (68.54%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            M++++KNK  ++TGG+ GIG AI E FL    + V+I++T E +G E  + L  +YG  K I++K DV  DL+ ++ K++E++ T+D+L
Sbjct:    1 MKRDLKNKTIVITGGAVGIGYAIAESFLQRNPRVVIILNTNEERGREATKNLAAKYGKNKVIYYKCDVRTDLEVVFNKIIEEFTTVDVL 89          
BLAST of OSCA025896-RA vs. genbank:protein
Match: gi|909581593|ref|XP_013146791.1| (PREDICTED: alcohol dehydrogenase 2-like [Papilio polytes])

HSP 1 Score: 83.5741 bits (205), Expect = 1.122e-17
Identity = 37/89 (41.57%), Postives = 60/89 (67.42%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELMEKLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL 89
            M +E++NK  ++TGG+ GIG AI + FL    K V+I+D  E  G E +E+L  +YG+ K  F+K DVT DL+ I+ ++++ + T+D+L
Sbjct:    1 MARELQNKTIVITGGAVGIGYAIADSFLEKNPKIVIILDINEKLGAEAIERLAAKYGENKVAFYKCDVTTDLEAIFNEIIKTFSTVDVL 89          
The following BLAST results are available for this feature:
BLAST of OSCA025896-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|914572857|gb|KOB75589.1|4.081e-2147.19Alcohol dehydrogenase [Operophtera brumata][more]
gi|943958872|ref|XP_014362108.1|9.162e-2148.31PREDICTED: alcohol dehydrogenase 1-like [Papilio m... [more]
gi|509177969|gb|JAA87105.1|6.831e-2043.82Alcohol dehydrogenase [Pararge aegeria][more]
gi|874594779|gb|AKQ06148.1|2.009e-1944.94alcohol dehydrogenase AD2 [Cydia pomonella][more]
gi|943958889|ref|XP_014362115.1|2.383e-1943.82PREDICTED: alcohol dehydrogenase-like [Papilio mac... [more]
gi|943958899|ref|XP_014362119.1|2.441e-1943.82PREDICTED: alcohol dehydrogenase 1-like [Papilio m... [more]
gi|768436712|ref|XP_011559858.1|1.539e-1840.91PREDICTED: 15-hydroxyprostaglandin dehydrogenase [... [more]
gi|930661799|gb|KPJ03686.1|8.701e-1841.5715-hydroxyprostaglandin dehydrogenase [NAD+] [Papi... [more]
gi|909581595|ref|XP_013146792.1|1.076e-1740.45PREDICTED: alcohol dehydrogenase-like [Papilio pol... [more]
gi|909581593|ref|XP_013146791.1|1.122e-1741.57PREDICTED: alcohol dehydrogenase 2-like [Papilio p... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008152 metabolic process
molecular_function GO:0016491 oxidoreductase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Glucose/ribitol dehydrogenasePRINTSPR00081GDHRDHcoord: 84..89
score: 20.05
coord: 9..26
score: 52.37
IPR016040NAD(P)-binding domainGENE3D3.40.50.720coord: 2..89
e-value: 9.4E-20
score: 70.1
IPR002198Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 8..88
e-value: 1.9E-9
score: 37.5
NoneNo IPR availablePANTHERPTHR24322FAMILY NOT NAMEDcoord: 4..89
NoneNo IPR availablePANTHERPTHR24322:SF288SUBFAMILY NOT NAMEDcoord: 4..89
NoneNo IPR availableSUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 4..89

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_23282contignewscf_23282:2384..2650 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025896-RAOSCA025896-RAOstrinia scapulalismRNAnewscf_23282 2384..2650 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025896-PA ID=OSCA025896-PA|Name=OSCA025896-RA|organism=Ostrinia scapulalis|type=polypeptide|length=89bp
MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDTEESQGIELME
KLNIQYGDGKTIFFKADVTRDLDEIYKKVVEKYQTIDIL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR002198DH_sc/Rdtase_SDR
IPR016040NAD(P)-bd_dom
IPR002347Glc/ribitol_DH