OSCA025898-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025898-RA
Unique NameOSCA025898-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length96
Homology
BLAST of OSCA025898-RA vs. genbank:protein
Match: gi|930671185|gb|KPJ11965.1| (hypothetical protein RR48_03568 [Papilio machaon])

HSP 1 Score: 63.1586 bits (152), Expect = 2.494e-11
Identity = 36/68 (52.94%), Postives = 39/68 (57.35%), Query Frame = 0
Query:    1 MAAGAEKISSSDHEPEDVVWAGLPLGGPRIW-RSREVPGCGRRRTSLCGNPWGRPLSSSGRHSAETND 67
            MA GA K  +  H   D  WAGLP  GP IW R RE PGC   RT   G  WGRP+ SSGR+ AE  D
Sbjct:    1 MADGAAKFWNCGHVQVDAAWAGLPQDGPMIWSRLREYPGCELHRTDHRGVLWGRPMPSSGRNEAEWMD 68          
BLAST of OSCA025898-RA vs. genbank:protein
Match: gi|930682061|gb|KPJ21601.1| (hypothetical protein RR48_00601 [Papilio machaon])

HSP 1 Score: 60.8474 bits (146), Expect = 2.301e-10
Identity = 32/56 (57.14%), Postives = 35/56 (62.50%), Query Frame = 0
Query:   13 HEPEDVVWAGLPLGGPRIW-RSREVPGCGRRRTSLCGNPWGRPLSSSGRHSAETND 67
            H   D  WAGLP  GP IW R RE PGCG  RT   G+ WGRP+ SSGR+ AE  D
Sbjct:   12 HVQVDAAWAGLPQDGPMIWSRLREYPGCGWHRTDHRGDIWGRPMPSSGRYEAEWMD 67          
BLAST of OSCA025898-RA vs. genbank:protein
Match: gi|930667674|gb|KPJ08757.1| (NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial [Papilio machaon])

HSP 1 Score: 61.6178 bits (148), Expect = 3.787e-9
Identity = 33/64 (51.56%), Postives = 36/64 (56.25%), Query Frame = 0
Query:    2 AAGAEKISSSDHEPEDVVWAGLPLGGPRIW-RSREVPGCGRRRTSLCGNPWGRPLSSSGRHSAE 64
            A GA K  +  H   D  W G P  GP IW R RE PGCG  RT   G+ WGRP  SSGR+ AE
Sbjct:   35 ADGAAKYWNDGHGQVDAAWTGFPQDGPMIWSRLREYPGCGLHRTDHRGDLWGRPKPSSGRYMAE 98          
The following BLAST results are available for this feature:
BLAST of OSCA025898-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 3
Match NameE-valueIdentityDescription
gi|930671185|gb|KPJ11965.1|2.494e-1152.94hypothetical protein RR48_03568 [Papilio machaon][more]
gi|930682061|gb|KPJ21601.1|2.301e-1057.14hypothetical protein RR48_00601 [Papilio machaon][more]
gi|930667674|gb|KPJ08757.1|3.787e-951.56NADH dehydrogenase [ubiquinone] flavoprotein 2, mi... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_42794contignewscf_42794:782..1072 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025898-RAOSCA025898-RAOstrinia scapulalismRNAnewscf_42794 782..1072 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025898-PA ID=OSCA025898-PA|Name=OSCA025898-RA|organism=Ostrinia scapulalis|type=polypeptide|length=96bp
MAAGAEKISSSDHEPEDVVWAGLPLGGPRIWRSREVPGCGRRRTSLCGNP
WGRPLSSSGRHSAETNDPLGVSQTVNICAISSAIKFPYETIKIKKF
back to top