OSCA025899-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025899-RA
Unique NameOSCA025899-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length81
Homology
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|930681929|gb|KPJ21469.1| (Solute carrier family 12 member 2 [Papilio machaon])

HSP 1 Score: 85.8853 bits (211), Expect = 6.917e-20
Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDDGSYT 53
            MASLLSKFRIDYSALKMVSD+ KKPRD+TLAYF+KL+APF +TDD  D+   T
Sbjct:    1 MASLLSKFRIDYSALKMVSDVNKKPRDTTLAYFDKLVAPFMTTDDNVDNMGIT 53          
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|913328353|ref|XP_013195682.1| (PREDICTED: bumetanide-sensitive sodium-(potassium)-chloride cotransporter [Amyelois transitella])

HSP 1 Score: 90.8929 bits (224), Expect = 1.647e-19
Identity = 40/53 (75.47%), Postives = 48/53 (90.57%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDDGSYT 53
            MASLLSKFRIDYSALKM+ DITK+PRDSTLAYFE+LIAPF+++D++ND    T
Sbjct: 1027 MASLLSKFRIDYSALKMIPDITKRPRDSTLAYFERLIAPFKTSDESNDQTGIT 1079          
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|930674071|gb|KPJ14477.1| (Bumetanide-sensitive sodium-(potassium)-chloride cotransporter [Papilio machaon])

HSP 1 Score: 89.7373 bits (221), Expect = 3.224e-19
Identity = 40/52 (76.92%), Postives = 46/52 (88.46%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDDGSY 52
            MASLLSKFRIDYSALKMVSD+ KKPRD+TLAYF+KL+APF +TDD  D+  Y
Sbjct: 1092 MASLLSKFRIDYSALKMVSDVNKKPRDTTLAYFDKLVAPFMTTDDNVDNSQY 1143          
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|910333281|ref|XP_013170025.1| (PREDICTED: bumetanide-sensitive sodium-(potassium)-chloride cotransporter isoform X4 [Papilio xuthus])

HSP 1 Score: 87.8113 bits (216), Expect = 1.759e-18
Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDDGSYT 53
            MASLLSKFRIDYSALKMVSD+ KKPRD+TLAYF+KL+APF +TDD  D+   T
Sbjct:  794 MASLLSKFRIDYSALKMVSDVNKKPRDATLAYFDKLVAPFMTTDDNVDNMGIT 846          
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|930654739|gb|KPI97072.1| (Bumetanide-sensitive sodium-(potassium)-chloride cotransporter [Papilio xuthus])

HSP 1 Score: 87.4261 bits (215), Expect = 2.661e-18
Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDDGSYT 53
            MASLLSKFRIDYSALKMVSD+ KKPRD+TLAYF+KL+APF +TDD  D+   T
Sbjct:  981 MASLLSKFRIDYSALKMVSDVNKKPRDATLAYFDKLVAPFMTTDDNVDNMGIT 1033          
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|910333279|ref|XP_013170024.1| (PREDICTED: bumetanide-sensitive sodium-(potassium)-chloride cotransporter isoform X3 [Papilio xuthus])

HSP 1 Score: 86.6557 bits (213), Expect = 3.807e-18
Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDDGSYT 53
            MASLLSKFRIDYSALKMVSD+ KKPRD+TLAYF+KL+APF +TDD  D+   T
Sbjct:  893 MASLLSKFRIDYSALKMVSDVNKKPRDATLAYFDKLVAPFMTTDDNVDNMGIT 945          
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|910333277|ref|XP_013170023.1| (PREDICTED: bumetanide-sensitive sodium-(potassium)-chloride cotransporter isoform X2 [Papilio xuthus])

HSP 1 Score: 86.2705 bits (212), Expect = 5.799e-18
Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDDGSYT 53
            MASLLSKFRIDYSALKMVSD+ KKPRD+TLAYF+KL+APF +TDD  D+   T
Sbjct:  988 MASLLSKFRIDYSALKMVSDVNKKPRDATLAYFDKLVAPFMTTDDNVDNMGIT 1040          
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|910333275|ref|XP_013170022.1| (PREDICTED: bumetanide-sensitive sodium-(potassium)-chloride cotransporter isoform X1 [Papilio xuthus])

HSP 1 Score: 86.2705 bits (212), Expect = 6.779e-18
Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDDGSYT 53
            MASLLSKFRIDYSALKMVSD+ KKPRD+TLAYF+KL+APF +TDD  D+   T
Sbjct: 1009 MASLLSKFRIDYSALKMVSDVNKKPRDATLAYFDKLVAPFMTTDDNVDNMGIT 1061          
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|943952610|ref|XP_014359172.1| (PREDICTED: bumetanide-sensitive sodium-(potassium)-chloride cotransporter-like [Papilio machaon])

HSP 1 Score: 85.8853 bits (211), Expect = 8.402e-18
Identity = 39/49 (79.59%), Postives = 45/49 (91.84%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDD 49
            MASLLSKFRIDYSALKMVSD+ KKPRD+TLAYF+KL+APF +TDD  D+
Sbjct: 1100 MASLLSKFRIDYSALKMVSDVNKKPRDTTLAYFDKLVAPFMTTDDNVDN 1148          
BLAST of OSCA025899-RA vs. genbank:protein
Match: gi|909570340|ref|XP_013140711.1| (PREDICTED: bumetanide-sensitive sodium-(potassium)-chloride cotransporter [Papilio polytes])

HSP 1 Score: 85.1149 bits (209), Expect = 1.426e-17
Identity = 38/49 (77.55%), Postives = 44/49 (89.80%), Query Frame = 0
Query:    1 MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDD 49
            MASLLSKFRIDYSALKMVSD+ KKPRD TLAYF+KL+AP+ +TDD  D+
Sbjct:  878 MASLLSKFRIDYSALKMVSDVNKKPRDVTLAYFDKLVAPYMTTDDNADN 926          
The following BLAST results are available for this feature:
BLAST of OSCA025899-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930681929|gb|KPJ21469.1|6.917e-2075.47Solute carrier family 12 member 2 [Papilio machaon... [more]
gi|913328353|ref|XP_013195682.1|1.647e-1975.47PREDICTED: bumetanide-sensitive sodium-(potassium)... [more]
gi|930674071|gb|KPJ14477.1|3.224e-1976.92Bumetanide-sensitive sodium-(potassium)-chloride c... [more]
gi|910333281|ref|XP_013170025.1|1.759e-1875.47PREDICTED: bumetanide-sensitive sodium-(potassium)... [more]
gi|930654739|gb|KPI97072.1|2.661e-1875.47Bumetanide-sensitive sodium-(potassium)-chloride c... [more]
gi|910333279|ref|XP_013170024.1|3.807e-1875.47PREDICTED: bumetanide-sensitive sodium-(potassium)... [more]
gi|910333277|ref|XP_013170023.1|5.799e-1875.47PREDICTED: bumetanide-sensitive sodium-(potassium)... [more]
gi|910333275|ref|XP_013170022.1|6.779e-1875.47PREDICTED: bumetanide-sensitive sodium-(potassium)... [more]
gi|943952610|ref|XP_014359172.1|8.402e-1879.59PREDICTED: bumetanide-sensitive sodium-(potassium)... [more]
gi|909570340|ref|XP_013140711.1|1.426e-1777.55PREDICTED: bumetanide-sensitive sodium-(potassium)... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:1902476 chloride transmembrane transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0015377 cation:chloride symporter activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_445contignewscf_445:620..865 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025899-RAOSCA025899-RAOstrinia scapulalismRNAnewscf_445 620..865 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025899-PA ID=OSCA025899-PA|Name=OSCA025899-RA|organism=Ostrinia scapulalis|type=polypeptide|length=81bp
MASLLSKFRIDYSALKMVSDITKKPRDSTLAYFEKLIAPFRSTDDTNDDG
SYTIQYQCIGSTIRVEAIKKEKINICIRSSR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:1902476chloride transmembrane transport
Vocabulary: Molecular Function
TermDefinition
GO:0015377cation:chloride symporter activity