OSCA025900-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025900-RA
Unique NameOSCA025900-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length107
Homology
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|943942645|ref|XP_014354855.1| (PREDICTED: b(0,+)-type amino acid transporter 1 [Papilio machaon] >gi|943942648|ref|XP_014354856.1| PREDICTED: b(0,+)-type amino acid transporter 1 [Papilio machaon])

HSP 1 Score: 195.282 bits (495), Expect = 3.844e-58
Identity = 95/107 (88.79%), Postives = 103/107 (96.26%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            ALLT+ FI+VGNI+TLIEFASWFLWFFYGLAMVALLVLR+TQA KPRPY+VPTLVPCFVL+VAIFLSILPIVHDPSVKYLMA+GFIVLGV VYTVFVY+KKTPTA L
Sbjct:  368 ALLTSVFILVGNIRTLIEFASWFLWFFYGLAMVALLVLRRTQADKPRPYKVPTLVPCFVLIVAIFLSILPIVHDPSVKYLMAIGFIVLGVGVYTVFVYYKKTPTAFL 474          
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|910334772|ref|XP_013170826.1| (PREDICTED: b(0,+)-type amino acid transporter 1 [Papilio xuthus] >gi|910334774|ref|XP_013170827.1| PREDICTED: b(0,+)-type amino acid transporter 1 [Papilio xuthus] >gi|910334776|ref|XP_013170828.1| PREDICTED: b(0,+)-type amino acid transporter 1 [Papilio xuthus])

HSP 1 Score: 195.282 bits (495), Expect = 3.883e-58
Identity = 95/107 (88.79%), Postives = 103/107 (96.26%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            ALLT+ FI+VGNI+TLIEFASWFLWFFYGLAMVALLVLR+TQA KPRPYRVPTLVPCFVL+VAIFLSILPIVHDPSVKYLMA+GFIVLGV VYTVFVY++KTPTA L
Sbjct:  369 ALLTSVFILVGNIRTLIEFASWFLWFFYGLAMVALLVLRRTQADKPRPYRVPTLVPCFVLVVAIFLSILPIVHDPSVKYLMAIGFIVLGVGVYTVFVYYRKTPTAFL 475          
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|913324749|ref|XP_013193709.1| (PREDICTED: b(0,+)-type amino acid transporter 1 isoform X1 [Amyelois transitella])

HSP 1 Score: 194.126 bits (492), Expect = 1.453e-57
Identity = 94/107 (87.85%), Postives = 101/107 (94.39%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            A LTT FI VGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQA KPRPYRVPT VPCFVLLVAIFLS+LPIVHDPS+KYLMA+GFIVLGV+VYT+FVY+KKTPT +L
Sbjct:  383 AFLTTIFISVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQANKPRPYRVPTPVPCFVLLVAIFLSVLPIVHDPSIKYLMAIGFIVLGVIVYTLFVYYKKTPTVIL 489          
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|913324751|ref|XP_013193710.1| (PREDICTED: b(0,+)-type amino acid transporter 1 isoform X2 [Amyelois transitella])

HSP 1 Score: 193.741 bits (491), Expect = 1.636e-57
Identity = 94/107 (87.85%), Postives = 101/107 (94.39%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            A LTT FI VGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQA KPRPYRVPT VPCFVLLVAIFLS+LPIVHDPS+KYLMA+GFIVLGV+VYT+FVY+KKTPT +L
Sbjct:  371 AFLTTIFISVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQANKPRPYRVPTPVPCFVLLVAIFLSVLPIVHDPSIKYLMAIGFIVLGVIVYTLFVYYKKTPTVIL 477          
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|930677657|gb|KPJ17708.1| (B(0,+)-type amino acid transporter 1 [Papilio machaon])

HSP 1 Score: 197.208 bits (500), Expect = 2.224e-57
Identity = 95/107 (88.79%), Postives = 103/107 (96.26%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            ALLT+ FI+VGNI+TLIEFASWFLWFFYGLAMVALLVLR+TQA KPRPY+VPTLVPCFVL+VAIFLSILPIVHDPSVKYLMA+GFIVLGV VYTVFVY+KKTPTA L
Sbjct:  571 ALLTSVFILVGNIRTLIEFASWFLWFFYGLAMVALLVLRRTQADKPRPYKVPTLVPCFVLIVAIFLSILPIVHDPSVKYLMAIGFIVLGVGVYTVFVYYKKTPTAFL 677          
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|930652927|gb|KPI95265.1| (B(0,+)-type amino acid transporter 1 [Papilio xuthus])

HSP 1 Score: 196.823 bits (499), Expect = 3.007e-57
Identity = 95/107 (88.79%), Postives = 103/107 (96.26%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            ALLT+ FI+VGNI+TLIEFASWFLWFFYGLAMVALLVLR+TQA KPRPYRVPTLVPCFVL+VAIFLSILPIVHDPSVKYLMA+GFIVLGV VYTVFVY++KTPTA L
Sbjct:  567 ALLTSVFILVGNIRTLIEFASWFLWFFYGLAMVALLVLRRTQADKPRPYRVPTLVPCFVLVVAIFLSILPIVHDPSVKYLMAIGFIVLGVGVYTVFVYYRKTPTAFL 673          
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|909583529|ref|XP_013147822.1| (PREDICTED: LOW QUALITY PROTEIN: b(0,+)-type amino acid transporter 1 [Papilio polytes])

HSP 1 Score: 192.586 bits (488), Expect = 3.321e-57
Identity = 93/107 (86.92%), Postives = 103/107 (96.26%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            A+LT+ FI+VGNI+TLIEFASWFLWFFYGLAMVALLVLR+TQA KPRPYRVPT VPCFVL+VAIFLSILPIVHDPSVKYLMA+GFIVLG+ VYTVFVY+KKTPTA+L
Sbjct:  365 AILTSVFILVGNIRTLIEFASWFLWFFYGLAMVALLVLRRTQADKPRPYRVPTPVPCFVLIVAIFLSILPIVHDPSVKYLMAIGFIVLGIGVYTVFVYYKKTPTAIL 471          
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|827541669|ref|XP_012544065.1| (PREDICTED: b(0,+)-type amino acid transporter 1 isoform X2 [Bombyx mori])

HSP 1 Score: 162.155 bits (409), Expect = 1.522e-46
Identity = 88/107 (82.24%), Postives = 99/107 (92.52%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            A LT  FI VGNIKTLI+FASWFLWFFYGLAMVALLVLRKTQA KPRPYRVPT +P FVL+VAIFLS+LPIV DPSVKYLMA+GFI+LGV+VYTVFVY+K+TP+AL+
Sbjct:  244 AFLTAIFISVGNIKTLIQFASWFLWFFYGLAMVALLVLRKTQAAKPRPYRVPTPIPVFVLIVAIFLSVLPIVEDPSVKYLMAIGFILLGVVVYTVFVYYKRTPSALI 350          
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|512897202|ref|XP_004924096.1| (PREDICTED: b(0,+)-type amino acid transporter 1 isoform X1 [Bombyx mori])

HSP 1 Score: 162.54 bits (410), Expect = 1.358e-45
Identity = 88/107 (82.24%), Postives = 99/107 (92.52%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            A LT  FI VGNIKTLI+FASWFLWFFYGLAMVALLVLRKTQA KPRPYRVPT +P FVL+VAIFLS+LPIV DPSVKYLMA+GFI+LGV+VYTVFVY+K+TP+AL+
Sbjct:  370 AFLTAIFISVGNIKTLIQFASWFLWFFYGLAMVALLVLRKTQAAKPRPYRVPTPIPVFVLIVAIFLSVLPIVEDPSVKYLMAIGFILLGVVVYTVFVYYKRTPSALI 476          
BLAST of OSCA025900-RA vs. genbank:protein
Match: gi|768445716|ref|XP_011564772.1| (PREDICTED: b(0,+)-type amino acid transporter 1-like [Plutella xylostella])

HSP 1 Score: 158.688 bits (400), Expect = 3.417e-44
Identity = 81/107 (75.70%), Postives = 94/107 (87.85%), Query Frame = 0
Query:    1 ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYRVPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHKKTPTALL 107
            A+LT  F+++GNI+TLIEFASW+LWFFYG  MVALLVLRKT   K RPYRVPT+VPCFVLLVAIFLS+LPIVHDPSVKYL+AVG +V G +VY VFVYHKKTP+ L+
Sbjct:  363 AMLTAIFLIIGNIRTLIEFASWYLWFFYGACMVALLVLRKTHPHKHRPYRVPTIVPCFVLLVAIFLSVLPIVHDPSVKYLLAVGLLVAGFVVYVVFVYHKKTPSMLI 469          
The following BLAST results are available for this feature:
BLAST of OSCA025900-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|943942645|ref|XP_014354855.1|3.844e-5888.79PREDICTED: b(0,+)-type amino acid transporter 1 [P... [more]
gi|910334772|ref|XP_013170826.1|3.883e-5888.79PREDICTED: b(0,+)-type amino acid transporter 1 [P... [more]
gi|913324749|ref|XP_013193709.1|1.453e-5787.85PREDICTED: b(0,+)-type amino acid transporter 1 is... [more]
gi|913324751|ref|XP_013193710.1|1.636e-5787.85PREDICTED: b(0,+)-type amino acid transporter 1 is... [more]
gi|930677657|gb|KPJ17708.1|2.224e-5788.79B(0,+)-type amino acid transporter 1 [Papilio mach... [more]
gi|930652927|gb|KPI95265.1|3.007e-5788.79B(0,+)-type amino acid transporter 1 [Papilio xuth... [more]
gi|909583529|ref|XP_013147822.1|3.321e-5786.92PREDICTED: LOW QUALITY PROTEIN: b(0,+)-type amino ... [more]
gi|827541669|ref|XP_012544065.1|1.522e-4682.24PREDICTED: b(0,+)-type amino acid transporter 1 is... [more]
gi|512897202|ref|XP_004924096.1|1.358e-4582.24PREDICTED: b(0,+)-type amino acid transporter 1 is... [more]
gi|768445716|ref|XP_011564772.1|3.417e-4475.70PREDICTED: b(0,+)-type amino acid transporter 1-li... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0003333 amino acid transmembrane transport
cellular_component GO:0005887 integral component of plasma membrane
cellular_component GO:0016020 membrane
molecular_function GO:0015171 amino acid transmembrane transporter activity
molecular_function GO:0015297 antiporter activity
molecular_function GO:0015179 L-amino acid transmembrane transporter activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002293Amino acid/polyamine transporter IPFAMPF13520AA_permease_2coord: 5..90
e-value: 8.7E-7
score: 27.7
IPR002293Amino acid/polyamine transporter IPANTHERPTHR11785AMINO ACID TRANSPORTERcoord: 1..103
NoneNo IPR availablePANTHERPTHR11785:SF72SUBFAMILY NOT NAMEDcoord: 1..103
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 79..98
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 99..107
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 40..50
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 19..39
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..18
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 51..73
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 74..78
NoneNo IPR availableTMHMMTMhelixcoord: 50..72
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 77..99

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_21186contignewscf_21186:564..884 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025900-RAOSCA025900-RAOstrinia scapulalismRNAnewscf_21186 564..884 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025900-PA ID=OSCA025900-PA|Name=OSCA025900-RA|organism=Ostrinia scapulalis|type=polypeptide|length=107bp
ALLTTAFIVVGNIKTLIEFASWFLWFFYGLAMVALLVLRKTQAKKPRPYR
VPTLVPCFVLLVAIFLSILPIVHDPSVKYLMAVGFIVLGVLVYTVFVYHK
KTPTALL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0015297antiporter activity
GO:0015179L-amino acid transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
Vocabulary: Cellular Component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0003333amino acid transmembrane transport
Vocabulary: INTERPRO
TermDefinition
IPR002293AA/rel_permease1