OSCA025901-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025901-RA
Unique NameOSCA025901-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length88
Homology
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|927348090|gb|ALE15212.1| (trypsin-like serine protease precursor [Diatraea saccharalis])

HSP 1 Score: 98.9821 bits (245), Expect = 2.101e-23
Identity = 47/86 (54.65%), Postives = 64/86 (74.42%), Query Frame = 0
Query:    1 FVNQPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFGTVA 86
            F+NQPS +  +VGTS+R SGGT Y +S+I+ H  YS  TLEHDIA+ +T+ +IVF  +VAP+ +AP G+T P+  EA+VTGFG  A
Sbjct:   83 FLNQPSSLVAAVGTSQRSSGGTTYSISRIIIHELYSNKTLEHDIALAITTQSIVFGLNVAPVTIAPLGITLPNNAEAIVTGFGATA 168          
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|913318599|ref|XP_013190337.1| (PREDICTED: trypsin-1-like [Amyelois transitella])

HSP 1 Score: 95.1301 bits (235), Expect = 4.667e-22
Identity = 46/86 (53.49%), Postives = 62/86 (72.09%), Query Frame = 0
Query:    1 FVNQPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFGTVA 86
            +V+ PSL+RV VGTS RLSGG  YDVS+++ H  YS +TLE+DI ++VT+T I  S SV+ +  AP+    PDG EA+V+GFG  A
Sbjct:   81 YVSDPSLLRVVVGTSNRLSGGRSYDVSRVILHEDYSESTLENDIVLLVTATTIASSQSVSAVPFAPSNFDLPDGTEAIVSGFGATA 166          
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|364023625|gb|AEW46887.1| (seminal fluid protein CSSFP037 [Chilo suppressalis] >gi|388540230|gb|AFK64823.1| trypsin-like proteinase [Chilo suppressalis])

HSP 1 Score: 95.1301 bits (235), Expect = 5.813e-22
Identity = 45/86 (52.33%), Postives = 61/86 (70.93%), Query Frame = 0
Query:    1 FVNQPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFGTVA 86
            +V+QP+ +  +VG+S+R SGGT Y +S+ L H  YS  TLEHDIA+ +TS NI F  +VA + +AP G+T P   EALVTGFG +A
Sbjct:   82 YVDQPTSVAAAVGSSQRNSGGTSYTISRFLIHELYSTMTLEHDIALAITSQNIAFDRTVASVSIAPVGMTIPPNAEALVTGFGRIA 167          
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|827541493|ref|XP_012543999.1| (PREDICTED: trypsin delta/gamma-like [Bombyx mori])

HSP 1 Score: 82.4185 bits (202), Expect = 3.272e-17
Identity = 42/84 (50.00%), Postives = 60/84 (71.43%), Query Frame = 0
Query:    1 FVNQPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFGT 84
            +V  PS+++V VGTS RLSGG  Y +S+I+ H  Y  +TLE+DIAV+ TS  + FS+SV  + +A + L+ P G EALV+G+GT
Sbjct:   83 YVLNPSVLKVVVGTSYRLSGGQSYAISRIIPHEQYLQSTLENDIAVVGTSKTMTFSASVNSVAIASSTLSLPIGSEALVSGYGT 166          
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|2853017|gb|AAC02218.1| (putative trypsin, partial [Scirpophaga incertulas])

HSP 1 Score: 79.337 bits (194), Expect = 1.589e-16
Identity = 43/86 (50.00%), Postives = 56/86 (65.12%), Query Frame = 0
Query:    1 FVNQPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFGTVA 86
            +V   S I  +VGT+ R SGGT Y VS+ + H  YS  TLEHDIA+   S +IVFS+ VA + +APAG   P   EALV+GFG ++
Sbjct:   10 YVFATSTIVAAVGTATRNSGGTTYAVSRFVLHEQYSELTLEHDIALAAVSQDIVFSAGVATVPVAPAGYIVPTNAEALVSGFGVIS 95          
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|914564545|gb|KOB69947.1| (Uncharacterized protein OBRU01_08515 [Operophtera brumata])

HSP 1 Score: 77.0258 bits (188), Expect = 2.377e-15
Identity = 38/75 (50.67%), Postives = 51/75 (68.00%), Query Frame = 0
Query:   12 VGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFGTVA 86
            VGT+ R+SGG  +D+SKI  H  Y  +TL +DIA++ T+  I FS SV PI  AP+    PDG EA+V+GFGT +
Sbjct:   62 VGTTSRVSGGKSHDISKIFIHELYCPSTLTNDIALLGTAKKISFSQSVLPITFAPSDFKIPDGAEAIVSGFGTTS 136          
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|910323448|ref|XP_013164764.1| (PREDICTED: trypsin-3-like [Papilio xuthus])

HSP 1 Score: 77.411 bits (189), Expect = 2.973e-15
Identity = 37/80 (46.25%), Postives = 54/80 (67.50%), Query Frame = 0
Query:    4 QPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFG 83
            +P L+R  VGTS RL+GG  YD+SK++ H  YS TTLE+DI++++T+  + FS+SV    +  A    P G  ALV+G+G
Sbjct:   86 EPPLLRAVVGTSYRLTGGKTYDLSKVIVHELYSTTTLENDISLLITTKRMTFSASVQAASIPNANFHLPVGSTALVSGYG 165          
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|930649051|gb|KPI91399.1| (Trypsin-1 [Papilio xuthus])

HSP 1 Score: 77.0258 bits (188), Expect = 3.291e-15
Identity = 37/80 (46.25%), Postives = 54/80 (67.50%), Query Frame = 0
Query:    4 QPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFG 83
            +P L+R  VGTS RL+GG  YD+SK++ H  YS TTLE+DI++++T+  + FS+SV    +  A    P G  ALV+G+G
Sbjct:   81 EPPLLRAVVGTSYRLTGGKTYDLSKVIVHELYSTTTLENDISLLITTKRMTFSASVQAASIPNANFHLPVGSTALVSGYG 160          
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|943937981|ref|XP_014370772.1| (PREDICTED: trypsin-1-like [Papilio machaon] >gi|930679005|gb|KPJ18922.1| Trypsin-1 [Papilio machaon])

HSP 1 Score: 76.2554 bits (186), Expect = 7.844e-15
Identity = 36/83 (43.37%), Postives = 56/83 (67.47%), Query Frame = 0
Query:    4 QPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFGTVA 86
            +P L+R  VGTS RL GG  Y++SK++ H  YS TTLE+DI++++T+  ++FS+SV    +  A    P G  ALV+G+G ++
Sbjct:   86 EPPLLRAVVGTSYRLIGGKTYELSKVVVHELYSTTTLENDISLVITTKRMIFSASVQAAGIPNANFLLPVGSTALVSGYGNIS 168          
BLAST of OSCA025901-RA vs. genbank:protein
Match: gi|768434424|ref|XP_011558622.1| (PREDICTED: trypsin-1-like [Plutella xylostella])

HSP 1 Score: 75.8702 bits (185), Expect = 1.179e-14
Identity = 41/83 (49.40%), Postives = 54/83 (65.06%), Query Frame = 0
Query:    1 FVNQPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTSTNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFG 83
            +   P  +RV VGTS R SGG+ Y V+K+  H  YS T+L +DIAV+ TS  IVFS  V PI + P G   PDG +A+V+G+G
Sbjct:   95 YKQNPDNLRVLVGTSYRSSGGSTYAVTKVQVHKDYSSTSLNNDIAVLQTSF-IVFSDKVLPIKIIPYGAFIPDGSQAIVSGYG 176          
The following BLAST results are available for this feature:
BLAST of OSCA025901-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|927348090|gb|ALE15212.1|2.101e-2354.65trypsin-like serine protease precursor [Diatraea s... [more]
gi|913318599|ref|XP_013190337.1|4.667e-2253.49PREDICTED: trypsin-1-like [Amyelois transitella][more]
gi|364023625|gb|AEW46887.1|5.813e-2252.33seminal fluid protein CSSFP037 [Chilo suppressalis... [more]
gi|827541493|ref|XP_012543999.1|3.272e-1750.00PREDICTED: trypsin delta/gamma-like [Bombyx mori][more]
gi|2853017|gb|AAC02218.1|1.589e-1650.00putative trypsin, partial [Scirpophaga incertulas][more]
gi|914564545|gb|KOB69947.1|2.377e-1550.67Uncharacterized protein OBRU01_08515 [Operophtera ... [more]
gi|910323448|ref|XP_013164764.1|2.973e-1546.25PREDICTED: trypsin-3-like [Papilio xuthus][more]
gi|930649051|gb|KPI91399.1|3.291e-1546.25Trypsin-1 [Papilio xuthus][more]
gi|943937981|ref|XP_014370772.1|7.844e-1543.37PREDICTED: trypsin-1-like [Papilio machaon] >gi|93... [more]
gi|768434424|ref|XP_011558622.1|1.179e-1449.40PREDICTED: trypsin-1-like [Plutella xylostella][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004252 serine-type endopeptidase activity
molecular_function GO:0008236 serine-type peptidase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D2.40.10.10coord: 9..85
e-value: 5.8E-15
score: 54.5
NoneNo IPR availablePANTHERPTHR24276FAMILY NOT NAMEDcoord: 5..85
IPR001254Peptidase S1PFAMPF00089Trypsincoord: 6..84
e-value: 5.8E-10
score: 39.0
IPR009003Trypsin-like cysteine/serine peptidase domainSUPERFAMILY50494Trypsin-like serine proteasescoord: 4..87

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_35488contignewscf_35488:619..885 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025901-RAOSCA025901-RAOstrinia scapulalismRNAnewscf_35488 619..885 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025901-PA ID=OSCA025901-PA|Name=OSCA025901-RA|organism=Ostrinia scapulalis|type=polypeptide|length=88bp
FVNQPSLIRVSVGTSRRLSGGTRYDVSKILSHAGYSVTTLEHDIAVIVTS
TNIVFSSSVAPIDLAPAGLTFPDGYEALVTGFGTVAVS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008236serine-type peptidase activity
GO:0004252serine-type endopeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: INTERPRO
TermDefinition
IPR009003Trypsin-like_Pept_dom
IPR001254Peptidase_S1