OSCA025902-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025902-RA
Unique NameOSCA025902-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length254
Homology
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|914576827|gb|KOB78639.1| (putative rho/rac-interacting citron kinase [Operophtera brumata])

HSP 1 Score: 375.941 bits (964), Expect = 4.825e-126
Identity = 171/248 (68.95%), Postives = 212/248 (85.48%), Query Frame = 0
Query:    8 VACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYIAGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCDTASLASTASECYMPEIFNLKVNEPVLLGTAPNGVIIRTKDDEGHRVSIVEGMAAFKSVGASVESLET-ISDSKGSSTDLAQSITDLTTPQDV 254
            VACGRRVF+LRFDA+ +EF+ +RSLTVDR P SLLLT+R LYIAGEKPLK+ LPSGALE F  +   +AAA ++HSPPKAILL+R+KP EILLCY ECGVFVDE G+RTR+EDPKWSS   +WE+V PFLY+ G+D+VT++Y+ D+ +++PPCTCD  S+AS+ SECYMPE+F LKVNEP LLGTAP G+II+TKDDE + V IVEGMAAF+S+GASVESL+T +SD+KGSS DLAQS TDL++P +V
Sbjct:  159 VACGRRVFILRFDATVSEFKTSRSLTVDRPPHSLLLTTRCLYIAGEKPLKINLPSGALETFASDVTTVAAATKQHSPPKAILLIREKPVEILLCYIECGVFVDEYGKRTRNEDPKWSSTIHSWEFVAPFLYIIGEDKVTIIYLNDEAYKSPPCTCDNHSVASSLSECYMPEVFELKVNEPSLLGTAPKGIIIQTKDDECYNVCIVEGMAAFRSIGASVESLDTVVSDAKGSSVDLAQSQTDLSSPHEV 406          
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|913317176|ref|XP_013189561.1| (PREDICTED: citron Rho-interacting kinase-like [Amyelois transitella])

HSP 1 Score: 402.519 bits (1033), Expect = 1.204e-125
Identity = 186/249 (74.70%), Postives = 221/249 (88.76%), Query Frame = 0
Query:    1 MEGPCAVVACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYIAGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCDTASLASTASECYMPEIFNLKVNEPVLLGTAPNGVIIRTKDDEGHRVSIVEGMAAFKSVGASVESLETISDSKGSSTDLAQSITDLT 249
            +E P A VAC RRVFLLRFDA++TEF+++RSLTVDRAP SLLLT+RALYIAGEKPLK+ LPSGALEAF ++EPIIAAAARKHSPP+AILL+R+ P EILLCYAE GVFVDENG+RTR+EDPKWS+A  AW +VHPFLYV G+DRVTV+Y+T++V+RAPPCTCDT SLAS+ S+CYMP+IFN+K+ EP LLGT   GVI+R+KDDE + V ++EGMAAFKS+GASVESLET SD K S TDLAQSITDL+
Sbjct: 1631 IEVPSAAVACSRRVFLLRFDAASTEFKLSRSLTVDRAPHSLLLTARALYIAGEKPLKINLPSGALEAFAIDEPIIAAAARKHSPPRAILLIRENPVEILLCYAELGVFVDENGKRTRNEDPKWSAAVHAWAFVHPFLYVIGEDRVTVVYLTEEVYRAPPCTCDTTSLASSTSDCYMPQIFNVKMKEPYLLGTTSTGVILRSKDDEKYNVILLEGMAAFKSIGASVESLETNSDMKSSMTDLAQSITDLS 1879          
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|357631651|gb|EHJ79120.1| (putative rho/rac-interacting citron kinase [Danaus plexippus])

HSP 1 Score: 361.303 bits (926), Expect = 1.948e-112
Identity = 166/254 (65.35%), Postives = 209/254 (82.28%), Query Frame = 0
Query:    2 EGPCAVVACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYIAGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCD--TASLASTASECYMPEIFNLKVNEPVLLGTAPNGVIIRTKDDEGHRVSIVEGMAAFKSVGASVESLETISDSKGSSTDLAQSITDLTTPQD 253
            EGPCA VACGRRV+LL+FDA+ T+F+ +RSLTVDR PSSLL+ +  LYIAGEKPLK+ LPSGALE+F M+EPII AA +KHS PKAIL +  KP E+LLCY ECGVFVDENG+RTR+EDPKWSSA   WEYV+PFLY  G+DRVT++Y+ +D ++APPCTCD  + + +++ASE Y P+IFN KV EP +LGTAPNG+I+R K D+ + + I+EG  AF+S+GAS++SL T SD KGSS DLAQS+TDL +PQD
Sbjct: 1010 EGPCAAVACGRRVYLLKFDATNTQFKTSRSLTVDRPPSSLLIANNVLYIAGEKPLKINLPSGALESFAMDEPIICAAFKKHSAPKAILQICSKPVELLLCYPECGVFVDENGKRTRNEDPKWSSAVHGWEYVNPFLYCVGEDRVTIIYINEDTYKAPPCTCDATSVASSTSASEYYQPDIFNYKVREPAILGTAPNGIIMRYKIDDDYNIIILEGKVAFRSIGASLDSLNTASDVKGSSLDLAQSLTDL-SPQD 1262          
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|930656479|gb|KPI98803.1| (Citron Rho-interacting kinase [Papilio xuthus])

HSP 1 Score: 356.681 bits (914), Expect = 1.185e-109
Identity = 175/251 (69.72%), Postives = 219/251 (87.25%), Query Frame = 0
Query:    2 EGPCAVVACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYIAGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCDTASLASTASECYMPEIFNLKVNEPVLLGTAPNGVIIRTKDDEGHRVSIVEGMAAFKSVGASVESLETISDSKGSSTDLAQSITDLTTPQ 252
            EGPCAVVACGRRVF+LRFDA+ TEF+IARSLT+DR PS+LLLT+R L++AGEKPLKV LP+GALE F ME+  +AAAAR HS P+A++LVR KP E+L+CYAECGVFVDE GRRTR EDPKWS+A  +WE+V PFLY  G DRVTV+Y++++ +RAPPCTCD++SLAS+ SECY+PE+FN KV EPVLLGTAPNG+IIR+  D+G+ VSI++G++AF+S+GAS+ESLETISDSKGSS+DL  S TDL+  +
Sbjct: 1419 EGPCAVVACGRRVFVLRFDAANTEFKIARSLTIDRPPSALLLTARHLFLAGEKPLKVNLPAGALETFAMEDATVAAAARAHSAPRALVLVRAKPLELLICYAECGVFVDEMGRRTRHEDPKWSAAVHSWEFVAPFLYAVGSDRVTVIYLSEEAYRAPPCTCDSSSLASSVSECYLPEVFNYKVREPVLLGTAPNGIIIRSTIDDGYSVSIIDGLSAFRSIGASLESLETISDSKGSSSDLTVSCTDLSQHE 1669          
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|910329317|ref|XP_013167911.1| (PREDICTED: citron Rho-interacting kinase isoform X2 [Papilio xuthus])

HSP 1 Score: 355.525 bits (911), Expect = 3.208e-109
Identity = 175/251 (69.72%), Postives = 219/251 (87.25%), Query Frame = 0
Query:    2 EGPCAVVACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYIAGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCDTASLASTASECYMPEIFNLKVNEPVLLGTAPNGVIIRTKDDEGHRVSIVEGMAAFKSVGASVESLETISDSKGSSTDLAQSITDLTTPQ 252
            EGPCAVVACGRRVF+LRFDA+ TEF+IARSLT+DR PS+LLLT+R L++AGEKPLKV LP+GALE F ME+  +AAAAR HS P+A++LVR KP E+L+CYAECGVFVDE GRRTR EDPKWS+A  +WE+V PFLY  G DRVTV+Y++++ +RAPPCTCD++SLAS+ SECY+PE+FN KV EPVLLGTAPNG+IIR+  D+G+ VSI++G++AF+S+GAS+ESLETISDSKGSS+DL  S TDL+  +
Sbjct: 1501 EGPCAVVACGRRVFVLRFDAANTEFKIARSLTIDRPPSALLLTARHLFLAGEKPLKVNLPAGALETFAMEDATVAAAARAHSAPRALVLVRAKPLELLICYAECGVFVDEMGRRTRHEDPKWSAAVHSWEFVAPFLYAVGSDRVTVIYLSEEAYRAPPCTCDSSSLASSVSECYLPEVFNYKVREPVLLGTAPNGIIIRSTIDDGYSVSIIDGLSAFRSIGASLESLETISDSKGSSSDLTVSCTDLSQHE 1751          
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|910329315|ref|XP_013167910.1| (PREDICTED: citron Rho-interacting kinase isoform X1 [Papilio xuthus])

HSP 1 Score: 355.525 bits (911), Expect = 3.745e-109
Identity = 175/251 (69.72%), Postives = 219/251 (87.25%), Query Frame = 0
Query:    2 EGPCAVVACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYIAGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCDTASLASTASECYMPEIFNLKVNEPVLLGTAPNGVIIRTKDDEGHRVSIVEGMAAFKSVGASVESLETISDSKGSSTDLAQSITDLTTPQ 252
            EGPCAVVACGRRVF+LRFDA+ TEF+IARSLT+DR PS+LLLT+R L++AGEKPLKV LP+GALE F ME+  +AAAAR HS P+A++LVR KP E+L+CYAECGVFVDE GRRTR EDPKWS+A  +WE+V PFLY  G DRVTV+Y++++ +RAPPCTCD++SLAS+ SECY+PE+FN KV EPVLLGTAPNG+IIR+  D+G+ VSI++G++AF+S+GAS+ESLETISDSKGSS+DL  S TDL+  +
Sbjct: 1523 EGPCAVVACGRRVFVLRFDAANTEFKIARSLTIDRPPSALLLTARHLFLAGEKPLKVNLPAGALETFAMEDATVAAAARAHSAPRALVLVRAKPLELLICYAECGVFVDEMGRRTRHEDPKWSAAVHSWEFVAPFLYAVGSDRVTVIYLSEEAYRAPPCTCDSSSLASSVSECYLPEVFNYKVREPVLLGTAPNGIIIRSTIDDGYSVSIIDGLSAFRSIGASLESLETISDSKGSSSDLTVSCTDLSQHE 1773          
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|943974350|ref|XP_014368475.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106718802 [Papilio machaon])

HSP 1 Score: 341.273 bits (874), Expect = 1.506e-108
Identity = 171/251 (68.13%), Postives = 217/251 (86.45%), Query Frame = 0
Query:    2 EGPCAVVACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYIAGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCDTASLASTASECYMPEIFNLKVNEPVLLGTAPNGVIIRTKDDEGHRVSIVEGMAAFKSVGASVESLETISDSKGSSTDLAQSITDLTTPQ 252
            EG CAVVACGRRVF+LRFDA+ TEF+IARSLT+DR PS+LLLT+R L++AGEKPLKV LP+GALE F ME+  +AAAAR HS P+A++LVR KP E+L+CYAECGVFVDE GRRTR EDPKWS+A  +WE+V PFLY  G DRVTV++++++ +RAPPCTCD++SLAS+ASECY+PE++N KV EPVLLGTAPNG+IIR+  D+G+ VSI++G+ AF+S+GAS+ESLETISD+K SS+DL  S TDL+  +
Sbjct:  493 EGLCAVVACGRRVFVLRFDAANTEFKIARSLTIDRPPSALLLTARHLFLAGEKPLKVNLPAGALETFAMEDATVAAAARAHSAPRALVLVRAKPLELLICYAECGVFVDELGRRTRHEDPKWSAAVHSWEFVAPFLYAVGSDRVTVIHLSEEAYRAPPCTCDSSSLASSASECYLPEVYNYKVREPVLLGTAPNGIIIRSTIDDGYSVSIIDGLGAFRSIGASLESLETISDNKSSSSDLTVSCTDLSQHE 743          
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|930666431|gb|KPJ07547.1| (Citron Rho-interacting kinase [Papilio machaon])

HSP 1 Score: 338.191 bits (866), Expect = 6.911e-108
Identity = 171/251 (68.13%), Postives = 217/251 (86.45%), Query Frame = 0
Query:    2 EGPCAVVACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYIAGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCDTASLASTASECYMPEIFNLKVNEPVLLGTAPNGVIIRTKDDEGHRVSIVEGMAAFKSVGASVESLETISDSKGSSTDLAQSITDLTTPQ 252
            EG CAVVACGRRVF+LRFDA+ TEF+IARSLT+DR PS+LLLT+R L++AGEKPLKV LP+GALE F ME+  +AAAAR HS P+A++LVR KP E+L+CYAECGVFVDE GRRTR EDPKWS+A  +WE+V PFLY  G DRVTV++++++ +RAPPCTCD++SLAS+ASECY+PE++N KV EPVLLGTAPNG+IIR+  D+G+ VSI++G+ AF+S+GAS+ESLETISD+K SS+DL  S TDL+  +
Sbjct:  414 EGLCAVVACGRRVFVLRFDAANTEFKIARSLTIDRPPSALLLTARHLFLAGEKPLKVNLPAGALETFAMEDATVAAAARAHSAPRALVLVRAKPLELLICYAECGVFVDELGRRTRHEDPKWSAAVHSWEFVAPFLYAVGSDRVTVIHLSEEAYRAPPCTCDSSSLASSASECYLPEVYNYKVREPVLLGTAPNGIIIRSTIDDGYSVSIIDGLGAFRSIGASLESLETISDNKSSSSDLTVSCTDLSQHE 664          
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|768446227|ref|XP_011565045.1| (PREDICTED: citron Rho-interacting kinase-like [Plutella xylostella])

HSP 1 Score: 313.153 bits (801), Expect = 1.192e-94
Identity = 151/252 (59.92%), Postives = 194/252 (76.98%), Query Frame = 0
Query:    2 EGPCAVVACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYIAGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCDTASLASTASECYMPE-IFNLKVNEPVLLGTAPNGVIIRTKDDEGHRVSIVEGMAAFKSVGASVESLETISDSKGSSTDLAQSITDLTTPQ 252
            +  C  VA  +RVFLLR+D S   F  +RSLTVDR PSSLLLT  ALYIAGE+PLK+ LPSG LE F ME   ++AAA+KHSPPKAILL+R+ P EIL+CY ECGVFVDENG++TRSE+PKWS AA  +E+V PFLY+ G++ + +++V D+ +RAPPCTCDT S+AS  S+CY  E +F+LKV +   LG AP+G++I++K      +S VEGMAAF+S+GASVESL TISD+KGS+  LAQS TD +T +
Sbjct: 1080 DAACVAVAGNQRVFLLRYDFSREAFTTSRSLTVDRRPSSLLLTPAALYIAGERPLKLKLPSGVLEHFAMENATVSAAAKKHSPPKAILLIREHPAEILICYNECGVFVDENGKKTRSEEPKWSIAADRFEFVSPFLYIVGNEMIDIVHVNDESYRAPPCTCDTDSVAS--SDCYATEHVFHLKVTDCTFLGKAPDGILIQSKVAGDLVISTVEGMAAFRSIGASVESLATISDTKGSTVSLAQSTTDPSTEE 1329          
BLAST of OSCA025902-RA vs. genbank:protein
Match: gi|509159123|gb|JAA77682.1| (putative citron Rho-interacting kinase-like protein, partial [Pararge aegeria])

HSP 1 Score: 175.637 bits (444), Expect = 6.911e-53
Identity = 75/98 (76.53%), Postives = 86/98 (87.76%), Query Frame = 0
Query:   99 LLCYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYVTDDVFRAPPCTCDTASLASTASECYMPEIFNLKVNEPVLLGTAPNG 196
            L+CYAECGVFVDENGRRTR+EDPKWSSA  +WEYV PFLYV G+DRVT++Y++DD +R+PPCTCDT SLASTASECY P+IFN K  EP LLG APNG
Sbjct:    1 LICYAECGVFVDENGRRTRNEDPKWSSAVHSWEYVSPFLYVVGEDRVTIIYISDDTYRSPPCTCDTTSLASTASECYQPDIFNYKCKEPFLLGAAPNG 98          
The following BLAST results are available for this feature:
BLAST of OSCA025902-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|914576827|gb|KOB78639.1|4.825e-12668.95putative rho/rac-interacting citron kinase [Operop... [more]
gi|913317176|ref|XP_013189561.1|1.204e-12574.70PREDICTED: citron Rho-interacting kinase-like [Amy... [more]
gi|357631651|gb|EHJ79120.1|1.948e-11265.35putative rho/rac-interacting citron kinase [Danaus... [more]
gi|930656479|gb|KPI98803.1|1.185e-10969.72Citron Rho-interacting kinase [Papilio xuthus][more]
gi|910329317|ref|XP_013167911.1|3.208e-10969.72PREDICTED: citron Rho-interacting kinase isoform X... [more]
gi|910329315|ref|XP_013167910.1|3.745e-10969.72PREDICTED: citron Rho-interacting kinase isoform X... [more]
gi|943974350|ref|XP_014368475.1|1.506e-10868.13PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|930666431|gb|KPJ07547.1|6.911e-10868.13Citron Rho-interacting kinase [Papilio machaon][more]
gi|768446227|ref|XP_011565045.1|1.192e-9459.92PREDICTED: citron Rho-interacting kinase-like [Plu... [more]
gi|509159123|gb|JAA77682.1|6.911e-5376.53putative citron Rho-interacting kinase-like protei... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016310 phosphorylation
molecular_function GO:0016301 kinase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001180Citron-likePFAMPF00780CNHcoord: 3..150
e-value: 3.4E-15
score: 56.1
NoneNo IPR availablePANTHERPTHR22988MYOTONIC DYSTROPHY S/T KINASE-RELATEDcoord: 4..139

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2185contignewscf_2185:3..764 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025902-RAOSCA025902-RAOstrinia scapulalismRNAnewscf_2185 3..764 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025902-PA ID=OSCA025902-PA|Name=OSCA025902-RA|organism=Ostrinia scapulalis|type=polypeptide|length=254bp
MEGPCAVVACGRRVFLLRFDASTTEFRIARSLTVDRAPSSLLLTSRALYI
AGEKPLKVLLPSGALEAFGMEEPIIAAAARKHSPPKAILLVRDKPTEILL
CYAECGVFVDENGRRTRSEDPKWSSAARAWEYVHPFLYVAGDDRVTVLYV
TDDVFRAPPCTCDTASLASTASECYMPEIFNLKVNEPVLLGTAPNGVIIR
TKDDEGHRVSIVEGMAAFKSVGASVESLETISDSKGSSTDLAQSITDLTT
PQDV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0016310phosphorylation
Vocabulary: Molecular Function
TermDefinition
GO:0016301kinase activity
Vocabulary: INTERPRO
TermDefinition
IPR001180Citron