OSCA025904-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025904-RA
Unique NameOSCA025904-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length38
Homology
The following BLAST results are available for this feature:
BLAST of OSCA025904-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_23425contignewscf_23425:3..119 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025904-RAOSCA025904-RAOstrinia scapulalismRNAnewscf_23425 3..119 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025904-PA ID=OSCA025904-PA|Name=OSCA025904-RA|organism=Ostrinia scapulalis|type=polypeptide|length=38bp
RRTVADEAMKIGKTWSEIKREAQDRTRWRTVSDALCPM
back to top