OSCA025905-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025905-RA
Unique NameOSCA025905-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length67
Homology
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 122.094 bits (305), Expect = 6.401e-32
Identity = 58/67 (86.57%), Postives = 61/67 (91.04%), Query Frame = 0
Query:    1 RRDDDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFG 67
            RR D RWGR+VLEWRPR GRRSVGRPPTRWTDDLVKVAG  WM+AAQDRSLWK+L EAFVQQWTSFG
Sbjct:  297 RRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 363          
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 122.865 bits (307), Expect = 1.625e-31
Identity = 58/67 (86.57%), Postives = 61/67 (91.04%), Query Frame = 0
Query:    1 RRDDDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFG 67
            RR D RWGR+VLEWRPR GRRSVGRPPTRWTDDLVKVAG  WM+AAQDRSLWK+L EAFVQQWTSFG
Sbjct:  431 RRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 497          
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 122.865 bits (307), Expect = 1.717e-31
Identity = 58/67 (86.57%), Postives = 61/67 (91.04%), Query Frame = 0
Query:    1 RRDDDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFG 67
            RR D RWGR+VLEWRPR GRRSVGRPPTRWTDDLVKVAG  WM+AAQDRSLWK+L EAFVQQWTSFG
Sbjct:  412 RRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 478          
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|930659181|gb|KPJ01280.1| (hypothetical protein RR46_01415 [Papilio xuthus])

HSP 1 Score: 112.849 bits (281), Expect = 2.732e-29
Identity = 49/64 (76.56%), Postives = 57/64 (89.06%), Query Frame = 0
Query:    2 RDDDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTS 65
            + D RWGR+VLEWRPR GRRSVG+PP RWTDDLVKVAG  WMRAAQDR+LW+++ EA+VQQWTS
Sbjct:   30 KTDGRWGRKVLEWRPRTGRRSVGKPPARWTDDLVKVAGVHWMRAAQDRALWQSMGEAYVQQWTS 93          
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 115.931 bits (289), Expect = 1.465e-28
Identity = 52/67 (77.61%), Postives = 60/67 (89.55%), Query Frame = 0
Query:    1 RRDDDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFG 67
            RR D RWGR VLEWRPR+GRRSVGRPP RWTDDLVKVAG  WMRAAQDR+LW+++ EA+VQQWT++G
Sbjct:  704 RRTDGRWGRRVLEWRPRIGRRSVGRPPARWTDDLVKVAGAHWMRAAQDRALWQSMGEAYVQQWTTYG 770          
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 103.99 bits (258), Expect = 6.146e-28
Identity = 50/64 (78.12%), Postives = 55/64 (85.94%), Query Frame = 0
Query:    4 DDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFG 67
            D RWGR+VLEWRPR GRRSVGRPP RWTDDLVKVAG +WMR AQDRS W++L EA+VQQW S G
Sbjct:    2 DGRWGRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYVQQWASHG 65          
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|930648975|gb|KPI91323.1| (hypothetical protein RR46_14827 [Papilio xuthus])

HSP 1 Score: 103.219 bits (256), Expect = 1.570e-27
Identity = 49/65 (75.38%), Postives = 55/65 (84.62%), Query Frame = 0
Query:    3 DDDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFG 67
            +D RWGR+VLEWRPR GRRSVGRPP RWTDDLVKVAG +WMR AQDRS W++L EA+ QQW S G
Sbjct:   18 EDGRWGRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASHG 82          
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 105.531 bits (262), Expect = 2.214e-27
Identity = 49/67 (73.13%), Postives = 56/67 (83.58%), Query Frame = 0
Query:    1 RRDDDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFG 67
            RR D RW R VLEWRPR G+RSVGRPP RWTDD+VK AG+ WMRAA DR+ WK+L EA+VQQWTS+G
Sbjct:   94 RRTDGRWSRRVLEWRPRTGKRSVGRPPARWTDDIVKSAGKHWMRAASDRTRWKSLGEAYVQQWTSYG 160          
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|930681500|gb|KPJ21040.1| (hypothetical protein RR48_00071 [Papilio machaon])

HSP 1 Score: 99.7525 bits (247), Expect = 2.702e-26
Identity = 48/63 (76.19%), Postives = 54/63 (85.71%), Query Frame = 0
Query:    5 DRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFG 67
             +WGR+VLEWRPR GRRSVGRPP RWTDDLVKVAG  WM AAQDRSLW+++ EA+VQQWT  G
Sbjct:   11 QKWGRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGVHWMLAAQDRSLWQSMGEAYVQQWTISG 73          
BLAST of OSCA025905-RA vs. genbank:protein
Match: gi|930654247|gb|KPI96582.1| (hypothetical protein RR46_12612 [Papilio xuthus])

HSP 1 Score: 98.9821 bits (245), Expect = 5.247e-26
Identity = 48/64 (75.00%), Postives = 53/64 (82.81%), Query Frame = 0
Query:    4 DDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRSLWKTLEEAFVQQWTSFG 67
            D RWGR+VLEWRP  GRRSVGRPP RWTDDLVKVAG +WMR AQDRS W++L EA+ QQW S G
Sbjct:    2 DGRWGRKVLEWRPWTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASHG 65          
The following BLAST results are available for this feature:
BLAST of OSCA025905-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001247|gb|ABO45233.1|6.401e-3286.57reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|1.625e-3186.57reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|1.717e-3186.57reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|930659181|gb|KPJ01280.1|2.732e-2976.56hypothetical protein RR46_01415 [Papilio xuthus][more]
gi|909577882|ref|XP_013144778.1|1.465e-2877.61PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|930681186|gb|KPJ20726.1|6.146e-2878.13hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|930648975|gb|KPI91323.1|1.570e-2775.38hypothetical protein RR46_14827 [Papilio xuthus][more]
gi|825740785|ref|WP_047149388.1|2.214e-2773.13hypothetical protein, partial [Escherichia coli][more]
gi|930681500|gb|KPJ21040.1|2.702e-2676.19hypothetical protein RR48_00071 [Papilio machaon][more]
gi|930654247|gb|KPI96582.1|5.247e-2675.00hypothetical protein RR46_12612 [Papilio xuthus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_29425contignewscf_29425:988..1191 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025905-RAOSCA025905-RAOstrinia scapulalismRNAnewscf_29425 988..1191 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025905-PA ID=OSCA025905-PA|Name=OSCA025905-RA|organism=Ostrinia scapulalis|type=polypeptide|length=67bp
RRDDDRWGREVLEWRPRVGRRSVGRPPTRWTDDLVKVAGRAWMRAAQDRS
LWKTLEEAFVQQWTSFG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity