OSCA025908-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025908-RA
Unique NameOSCA025908-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length85
Homology
BLAST of OSCA025908-RA vs. genbank:protein
Match: gi|509171691|gb|JAA83966.1| (endonuclease-reverse transcriptase [Pararge aegeria])

HSP 1 Score: 89.3521 bits (220), Expect = 1.478e-21
Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 0
Query:    1 VSRNENSMERLVVQGQVEGKRARDRSPTRWIDATTKATESNMVQCTRDAANRQKWKHIAR 60
            +SRNE S+ERLVVQGQVEGKRAR RSPTRWID     T++ +V+C R A NRQKW+ +AR
Sbjct:   32 ISRNEGSIERLVVQGQVEGKRARGRSPTRWIDTVKSLTQTTVVECFRHATNRQKWRRLAR 91          
BLAST of OSCA025908-RA vs. genbank:protein
Match: gi|509163701|gb|JAA79971.1| (endonuclease-reverse transcriptase [Pararge aegeria])

HSP 1 Score: 73.559 bits (179), Expect = 1.997e-15
Identity = 33/69 (47.83%), Postives = 50/69 (72.46%), Query Frame = 0
Query:    4 NENSMERLVVQGQVEGKRARDRSPTRWIDATTKATESNMVQCTRDAANRQKWKHIARRATLGDDIEHIT 72
            N++S+E LVV+G V GKR+R RSPTRW D    AT++++VQC+R+A +R KW+ IA  A   +++  +T
Sbjct:    2 NKHSIELLVVKGNVGGKRSRGRSPTRWTDVIKAATQTSIVQCSRNAEDRNKWRRIAGAAVAKENVSSLT 70          
BLAST of OSCA025908-RA vs. genbank:protein
Match: gi|298204333|gb|ADI61815.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 75.8702 bits (185), Expect = 3.411e-14
Identity = 34/60 (56.67%), Postives = 44/60 (73.33%), Query Frame = 0
Query:    1 VSRNENSMERLVVQGQVEGKRARDRSPTRWIDATTKATESNMVQCTRDAANRQKWKHIAR 60
            ++RNE+S+ERLVVQG+VEGKR+R RSPTRW D     T SN+  C+  A +R  W+ IAR
Sbjct:  941 ITRNEDSIERLVVQGKVEGKRSRGRSPTRWTDLIKSVTHSNLNACSHSAKHRATWRRIAR 1000          
BLAST of OSCA025908-RA vs. genbank:protein
Match: gi|930679191|gb|KPJ19108.1| (hypothetical protein RR48_12619 [Papilio machaon])

HSP 1 Score: 63.929 bits (154), Expect = 1.100e-11
Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = 0
Query:    3 RNENSMERLVVQGQVEGKRARDRSPTRWIDATTKATESNMVQCTRDAANRQKWKHIARRAT 63
            RN+ S+ERLVVQG++EG R R RSP RW D    A    + +CT+ A +R++W+ + +R T
Sbjct:   11 RNDESIERLVVQGKLEGTRPRGRSPMRWADQIRAAVAVPLHECTKKAESREEWRRLVQRVT 71          
BLAST of OSCA025908-RA vs. genbank:protein
Match: gi|930650527|gb|KPI92872.1| (hypothetical protein RR46_14093 [Papilio xuthus])

HSP 1 Score: 61.2326 bits (147), Expect = 2.737e-10
Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = 0
Query:    3 RNENSMERLVVQGQVEGKRARDRSPTRWIDATTKATESNMVQCTRDAANRQKWKHIARRAT 63
            R++ S++RLVVQG+VEG R R RSP R  D    A +  + QCT+ AA R++W+ + +R T
Sbjct:   43 RDDESIQRLVVQGKVEGNRPRGRSPMRRTDQIRAAVDVPLHQCTKKAATREEWRRLVKRVT 103          
BLAST of OSCA025908-RA vs. genbank:protein
Match: gi|298204343|gb|ADI61820.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 64.6994 bits (156), Expect = 2.863e-10
Identity = 32/69 (46.38%), Postives = 44/69 (63.77%), Query Frame = 0
Query:    3 RNENSMERLVVQGQVEGKRARDRSPTRWIDATTKATESNMVQCTRDAANRQKWKHIARRAT-LGDDIEH 70
            R ++S+ERLVVQG +EG R R RSP RW D    A    + +CTR AA R++W+ + +R T   DD +H
Sbjct:  938 RGDDSVERLVVQGMIEGTRPRRRSPLRWTDQIKAALNGPVNECTRRAAVREEWRRLVKRTTNRSDDHDH 1006          
BLAST of OSCA025908-RA vs. genbank:protein
Match: gi|298204359|gb|ADI61828.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 60.4622 bits (145), Expect = 8.873e-9
Identity = 27/59 (45.76%), Postives = 38/59 (64.41%), Query Frame = 0
Query:    3 RNENSMERLVVQGQVEGKRARDRSPTRWIDATTKATESNMVQCTRDAANRQKWKHIARR 61
            R+  S+ERLVVQG V+G R R R P RW D    A    + +C+R A++R++W+ I RR
Sbjct:  944 RDGRSIERLVVQGSVDGTRPRGRPPMRWTDQIKTAVGGPLNECSRMASSRERWRDIVRR 1002          
The following BLAST results are available for this feature:
BLAST of OSCA025908-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 7
Match NameE-valueIdentityDescription
gi|509171691|gb|JAA83966.1|1.478e-2166.67endonuclease-reverse transcriptase [Pararge aegeri... [more]
gi|509163701|gb|JAA79971.1|1.997e-1547.83endonuclease-reverse transcriptase [Pararge aegeri... [more]
gi|298204333|gb|ADI61815.1|3.411e-1456.67endonuclease-reverse transcriptase [Bombyx mori][more]
gi|930679191|gb|KPJ19108.1|1.100e-1145.90hypothetical protein RR48_12619 [Papilio machaon][more]
gi|930650527|gb|KPI92872.1|2.737e-1045.90hypothetical protein RR46_14093 [Papilio xuthus][more]
gi|298204343|gb|ADI61820.1|2.863e-1046.38endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204359|gb|ADI61828.1|8.873e-945.76endonuclease-reverse transcriptase [Bombyx mori][more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090304 nucleic acid metabolic process
molecular_function GO:0003824 catalytic activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_43938contignewscf_43938:651..908 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025908-RAOSCA025908-RAOstrinia scapulalismRNAnewscf_43938 651..908 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025908-PA ID=OSCA025908-PA|Name=OSCA025908-RA|organism=Ostrinia scapulalis|type=polypeptide|length=85bp
VSRNENSMERLVVQGQVEGKRARDRSPTRWIDATTKATESNMVQCTRDAA
NRQKWKHIARRATLGDDIEHITVNLVSATTTTQYG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0090304nucleic acid metabolic process