OSCA025910-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025910-RA
Unique NameOSCA025910-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length73
Homology
BLAST of OSCA025910-RA vs. genbank:protein
Match: gi|913331964|ref|XP_013197583.1| (PREDICTED: uncharacterized protein LOC106140531 [Amyelois transitella])

HSP 1 Score: 69.3218 bits (168), Expect = 3.017e-13
Identity = 34/65 (52.31%), Postives = 44/65 (67.69%), Query Frame = 0
Query:    8 NVRKRPPDHMTRKVLDIQTKPRGRGRPRIKWMSIINNDLKEVQVNGKTTQDRAAWRRMTRRADPR 72
            +V +R  DHMT+KVL ++   R RGRP + WM  I NDLK   +N +TT +R  WRR TRRADP+
Sbjct:   83 HVMRRDDDHMTKKVLSMEEGRRPRGRPPMTWMQTIKNDLKSTCINKQTTHNRVVWRRNTRRADPK 147          
BLAST of OSCA025910-RA vs. genbank:protein
Match: gi|930681322|gb|KPJ20862.1| (hypothetical protein RR48_00236 [Papilio machaon])

HSP 1 Score: 62.3882 bits (150), Expect = 2.412e-11
Identity = 28/65 (43.08%), Postives = 45/65 (69.23%), Query Frame = 0
Query:    8 NVRKRPPDHMTRKVLDIQTKPRGRGRPRIKWMSIINNDLKEVQVNGKTTQDRAAWRRMTRRADPR 72
            +V++RP DHM +  L++ T  R RGRP   W++ I  DLKE+ ++ + +++RA WR  TR+ADP+
Sbjct:   13 HVQRRPEDHMVKLALNLPTTTRNRGRPPTTWLTTIQKDLKEIDLDEQDSRNRAVWRIRTRKADPK 77          
BLAST of OSCA025910-RA vs. genbank:protein
Match: gi|914574553|gb|KOB76833.1| (Reverse transcriptase family member [Operophtera brumata])

HSP 1 Score: 65.0846 bits (157), Expect = 4.827e-11
Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = 0
Query:    8 NVRKRPPDHMTRKVLDIQTKPRGRGRPRIKWMSIINNDLKEVQVNGKTTQDRAAWRRMTRRADPR 72
            +V++ P DHM +  LD+ T  RGRG P   W+  +  DLKE Q +    QDRA WR+ TR+ADP+
Sbjct:  141 HVQRSPVDHMAKLALDLPTTRRGRGIPPSTWLKTVEKDLKEAQSDNDFAQDRAKWRKRTRKADPK 205          
BLAST of OSCA025910-RA vs. genbank:protein
Match: gi|943937990|ref|XP_014370775.1| (PREDICTED: uncharacterized protein LOC106720569 [Papilio machaon])

HSP 1 Score: 62.003 bits (149), Expect = 7.038e-10
Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 0
Query:    8 NVRKRPPDHMTRKVLDIQTKPRGRGRPRIKWMSIINNDLKEVQVNGKTTQDRAAWRRMTRRADPR 72
            +V++RP DHM +  L++ T  R RGRP   W++ I  DLKE+ ++ + +++ A WR  TR+ADP+
Sbjct:  185 HVQRRPEDHMVKLALNLPTTTRHRGRPPTTWLTTIQKDLKEIDLDEQDSRNHAVWRIRTRKADPK 249          
BLAST of OSCA025910-RA vs. genbank:protein
Match: gi|913307782|ref|XP_013184394.1| (PREDICTED: uncharacterized protein LOC106130165 [Amyelois transitella])

HSP 1 Score: 58.151 bits (139), Expect = 4.735e-9
Identity = 32/65 (49.23%), Postives = 42/65 (64.62%), Query Frame = 0
Query:    8 NVRKRPPDHMTRKVLDIQTKPRGRGRPRIKWMSIINNDLKEVQVNGKTTQDRAAWRRMTRRADPR 72
            +V +R  DHMT+KVL ++   R R RP + WM  I NDLK   +N +T  +R  WRR TRRADP+
Sbjct:   75 HVMRRDDDHMTKKVLSMEEGRRPRRRPPMTWMQTIKNDLKSTFINKQTNHNRVVWRRNTRRADPK 139          
BLAST of OSCA025910-RA vs. genbank:protein
Match: gi|1069805161|ref|XP_018326809.1| (PREDICTED: uncharacterized protein LOC108738080 [Agrilus planipennis])

HSP 1 Score: 56.9954 bits (136), Expect = 6.817e-9
Identity = 25/64 (39.06%), Postives = 41/64 (64.06%), Query Frame = 0
Query:    8 NVRKRPPDHMTRKVLDIQTKPRGRGRPRIKWMSIINNDLKEVQVNGKTTQDRAAWRRMTRRADP 71
            ++++RP DH+ +K L + TK RGRG+P   W+S +  D+K++ ++      R  WR  TR+ADP
Sbjct:   44 HIQRRPDDHVVKKCLSMATKERGRGKPPTTWVSNVRKDMKQLGLSDDDAYQRNKWRLSTRKADP 107          
The following BLAST results are available for this feature:
BLAST of OSCA025910-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 6
Match NameE-valueIdentityDescription
gi|913331964|ref|XP_013197583.1|3.017e-1352.31PREDICTED: uncharacterized protein LOC106140531 [A... [more]
gi|930681322|gb|KPJ20862.1|2.412e-1143.08hypothetical protein RR48_00236 [Papilio machaon][more]
gi|914574553|gb|KOB76833.1|4.827e-1146.15Reverse transcriptase family member [Operophtera b... [more]
gi|943937990|ref|XP_014370775.1|7.038e-1041.54PREDICTED: uncharacterized protein LOC106720569 [P... [more]
gi|913307782|ref|XP_013184394.1|4.735e-949.23PREDICTED: uncharacterized protein LOC106130165 [A... [more]
gi|1069805161|ref|XP_018326809.1|6.817e-939.06PREDICTED: uncharacterized protein LOC108738080 [A... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_14607contignewscf_14607:237..458 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025910-RAOSCA025910-RAOstrinia scapulalismRNAnewscf_14607 237..458 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025910-PA ID=OSCA025910-PA|Name=OSCA025910-RA|organism=Ostrinia scapulalis|type=polypeptide|length=73bp
MLVNAEMNVRKRPPDHMTRKVLDIQTKPRGRGRPRIKWMSIINNDLKEVQ
VNGKTTQDRAAWRRMTRRADPRK
back to top