OSCA025911-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025911-RA
Unique NameOSCA025911-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length60
Homology
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|913322566|ref|XP_013192507.1| (PREDICTED: protein diaphanous homolog 1 [Amyelois transitella])

HSP 1 Score: 112.079 bits (279), Expect = 2.185e-27
Identity = 55/60 (91.67%), Postives = 57/60 (95.00%), Query Frame = 0
Query:    1 LKKRTMERKQASSLLSSVGKSLGKSNSDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            LKKRTMERKQASSLLSSVGKSLGK+N DCNGH NGD+SRDGTL NGQKGEFDDLISALRT
Sbjct: 1003 LKKRTMERKQASSLLSSVGKSLGKANGDCNGHTNGDASRDGTLANGQKGEFDDLISALRT 1062          
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|768451123|ref|XP_011567740.1| (PREDICTED: disheveled-associated activator of morphogenesis 2-like, partial [Plutella xylostella])

HSP 1 Score: 107.457 bits (267), Expect = 2.461e-26
Identity = 55/64 (85.94%), Postives = 56/64 (87.50%), Query Frame = 0
Query:    1 LKKRTMERKQASSLLSSVGKSLG----KSNSDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            LKKRTMERKQASSLLSSVGKSLG      N DCNGH NGD+SRDGTLTNGQKGEFDDLISALRT
Sbjct:  296 LKKRTMERKQASSLLSSVGKSLGIGKSHKNGDCNGHTNGDTSRDGTLTNGQKGEFDDLISALRT 359          
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|930673527|gb|KPJ14016.1| (Disheveled-associated activator of morphogenesis 2 [Papilio machaon])

HSP 1 Score: 107.071 bits (266), Expect = 4.179e-26
Identity = 56/60 (93.33%), Postives = 57/60 (95.00%), Query Frame = 0
Query:    1 LKKRTMERKQASSLLSSVGKSLGKSNSDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            LKKRTMERKQASSLLSSVGKSLGK+NSDCNGH NGD SRD TLTNGQKGEFDDLISALRT
Sbjct:  309 LKKRTMERKQASSLLSSVGKSLGKANSDCNGH-NGD-SRDSTLTNGQKGEFDDLISALRT 366          
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|768412028|ref|XP_011566950.1| (PREDICTED: disheveled-associated activator of morphogenesis 1 [Plutella xylostella])

HSP 1 Score: 108.227 bits (269), Expect = 5.152e-26
Identity = 55/64 (85.94%), Postives = 56/64 (87.50%), Query Frame = 0
Query:    1 LKKRTMERKQASSLLSSVGKSLG----KSNSDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            LKKRTMERKQASSLLSSVGKSLG      N DCNGH NGD+SRDGTLTNGQKGEFDDLISALRT
Sbjct: 1053 LKKRTMERKQASSLLSSVGKSLGIGKSHKNGDCNGHTNGDTSRDGTLTNGQKGEFDDLISALRT 1116          
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|509159455|gb|JAA77848.1| (Dishevelled Associated Activator of Morphogenesis [Pararge aegeria])

HSP 1 Score: 97.8265 bits (242), Expect = 2.630e-25
Identity = 51/57 (89.47%), Postives = 53/57 (92.98%), Query Frame = 0
Query:    6 MERKQASSLLSSVGKSLGKSN--SDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            MERKQ SSLLSSVGKSLGKSN  SDCNGH+ GD+SRDGTLTNGQKGEFDDLISALRT
Sbjct:    1 MERKQGSSLLSSVGKSLGKSNGSSDCNGHSTGDNSRDGTLTNGQKGEFDDLISALRT 57          
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|910318150|ref|XP_013161888.1| (PREDICTED: formin-like protein 3 [Papilio xuthus])

HSP 1 Score: 104.76 bits (260), Expect = 8.397e-25
Identity = 57/60 (95.00%), Postives = 57/60 (95.00%), Query Frame = 0
Query:    1 LKKRTMERKQASSLLSSVGKSLGKSNSDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            LKKRTMERKQASSLLSSVGKSLGK NSDCNGH NGD SRDGTLTNGQKGEFDDLISALRT
Sbjct: 1048 LKKRTMERKQASSLLSSVGKSLGKGNSDCNGH-NGD-SRDGTLTNGQKGEFDDLISALRT 1105          
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|930648566|gb|KPI90914.1| (Disheveled-associated activator of morphogenesis 2 [Papilio xuthus])

HSP 1 Score: 103.99 bits (258), Expect = 1.378e-24
Identity = 57/60 (95.00%), Postives = 57/60 (95.00%), Query Frame = 0
Query:    1 LKKRTMERKQASSLLSSVGKSLGKSNSDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            LKKRTMERKQASSLLSSVGKSLGK NSDCNGH NGD SRDGTLTNGQKGEFDDLISALRT
Sbjct:  926 LKKRTMERKQASSLLSSVGKSLGKGNSDCNGH-NGD-SRDGTLTNGQKGEFDDLISALRT 983          
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|357611835|gb|EHJ67670.1| (disheveled associated activator of morphogenesis [Danaus plexippus])

HSP 1 Score: 102.064 bits (253), Expect = 4.329e-24
Identity = 52/60 (86.67%), Postives = 54/60 (90.00%), Query Frame = 0
Query:    1 LKKRTMERKQASSLLSSVGKSLGKSNSDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            LKKRTMERKQ SSLL SVGKSLGK+N DCNGH   D+SRDGTLTNGQKGEFDDLISALRT
Sbjct:  364 LKKRTMERKQGSSLLGSVGKSLGKTNGDCNGH---DASRDGTLTNGQKGEFDDLISALRT 420          
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|943953928|ref|XP_014359881.1| (PREDICTED: disheveled-associated activator of morphogenesis 1 [Papilio machaon])

HSP 1 Score: 102.064 bits (253), Expect = 6.287e-24
Identity = 56/60 (93.33%), Postives = 57/60 (95.00%), Query Frame = 0
Query:    1 LKKRTMERKQASSLLSSVGKSLGKSNSDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            LKKRTMERKQASSLLSSVGKSLGK+NSDCNGH NGD SRD TLTNGQKGEFDDLISALRT
Sbjct:  986 LKKRTMERKQASSLLSSVGKSLGKANSDCNGH-NGD-SRDSTLTNGQKGEFDDLISALRT 1043          
BLAST of OSCA025911-RA vs. genbank:protein
Match: gi|827551464|ref|XP_012547611.1| (PREDICTED: disheveled-associated activator of morphogenesis 1 isoform X3 [Bombyx mori])

HSP 1 Score: 93.9745 bits (232), Expect = 4.349e-21
Identity = 49/60 (81.67%), Postives = 54/60 (90.00%), Query Frame = 0
Query:    1 LKKRTMERKQASSLLSSVGKSLGKSNSDCNGHANGDSSRDGTLTNGQKGEFDDLISALRT 60
            LKKRTMERKQ++SL  SV KSL KSN DCNGH+N DSSRDGT++NGQKGEFDDLISALRT
Sbjct: 1020 LKKRTMERKQSNSL-GSVSKSLAKSNGDCNGHSN-DSSRDGTMSNGQKGEFDDLISALRT 1077          
The following BLAST results are available for this feature:
BLAST of OSCA025911-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913322566|ref|XP_013192507.1|2.185e-2791.67PREDICTED: protein diaphanous homolog 1 [Amyelois ... [more]
gi|768451123|ref|XP_011567740.1|2.461e-2685.94PREDICTED: disheveled-associated activator of morp... [more]
gi|930673527|gb|KPJ14016.1|4.179e-2693.33Disheveled-associated activator of morphogenesis 2... [more]
gi|768412028|ref|XP_011566950.1|5.152e-2685.94PREDICTED: disheveled-associated activator of morp... [more]
gi|509159455|gb|JAA77848.1|2.630e-2589.47Dishevelled Associated Activator of Morphogenesis ... [more]
gi|910318150|ref|XP_013161888.1|8.397e-2595.00PREDICTED: formin-like protein 3 [Papilio xuthus][more]
gi|930648566|gb|KPI90914.1|1.378e-2495.00Disheveled-associated activator of morphogenesis 2... [more]
gi|357611835|gb|EHJ67670.1|4.329e-2486.67disheveled associated activator of morphogenesis [... [more]
gi|943953928|ref|XP_014359881.1|6.287e-2493.33PREDICTED: disheveled-associated activator of morp... [more]
gi|827551464|ref|XP_012547611.1|4.349e-2181.67PREDICTED: disheveled-associated activator of morp... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_GRAM_POSITIVESignalP-TMSignalP-TMcoord: 1..14
score: 0.455

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_21719contignewscf_21719:377..556 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025911-RAOSCA025911-RAOstrinia scapulalismRNAnewscf_21719 377..556 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025911-PA ID=OSCA025911-PA|Name=OSCA025911-RA|organism=Ostrinia scapulalis|type=polypeptide|length=60bp
LKKRTMERKQASSLLSSVGKSLGKSNSDCNGHANGDSSRDGTLTNGQKGE
FDDLISALRT
back to top