OSCA025912-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025912-RA
Unique NameOSCA025912-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length86
Homology
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|930652254|gb|KPI94594.1| (Carbohydrate sulfotransferase 11 [Papilio xuthus])

HSP 1 Score: 158.688 bits (400), Expect = 3.763e-46
Identity = 74/86 (86.05%), Postives = 78/86 (90.70%), Query Frame = 0
Query:    1 VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ 86
            VACTNWKRILMIL GKWN TDVL IPASLAHSPGMFRNLS+VPK +R  MLD+YHKMIIVRNPFERLLSAYRNKLEGD  SA+YFQ
Sbjct:   85 VACTNWKRILMILAGKWNGTDVLAIPASLAHSPGMFRNLSTVPKEDRQVMLDNYHKMIIVRNPFERLLSAYRNKLEGDTQSAKYFQ 170          
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|910330383|ref|XP_013168487.1| (PREDICTED: carbohydrate sulfotransferase 11 [Papilio xuthus])

HSP 1 Score: 158.303 bits (399), Expect = 6.819e-46
Identity = 74/86 (86.05%), Postives = 78/86 (90.70%), Query Frame = 0
Query:    1 VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ 86
            VACTNWKRILMIL GKWN TDVL IPASLAHSPGMFRNLS+VPK +R  MLD+YHKMIIVRNPFERLLSAYRNKLEGD  SA+YFQ
Sbjct:   92 VACTNWKRILMILAGKWNGTDVLAIPASLAHSPGMFRNLSTVPKEDRQVMLDNYHKMIIVRNPFERLLSAYRNKLEGDTQSAKYFQ 177          
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|930666454|gb|KPJ07570.1| (Carbohydrate sulfotransferase 11 [Papilio machaon])

HSP 1 Score: 157.532 bits (397), Expect = 9.185e-46
Identity = 73/86 (84.88%), Postives = 78/86 (90.70%), Query Frame = 0
Query:    1 VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ 86
            VACTNWKRILMIL GKWN TDVL IPASLAH+PGMFRNLS+VPK +R  MLD+YHKMIIVRNPFERLLSAYRNKLEGD  SA+YFQ
Sbjct:   87 VACTNWKRILMILAGKWNGTDVLAIPASLAHTPGMFRNLSTVPKEDRQVMLDNYHKMIIVRNPFERLLSAYRNKLEGDTQSAKYFQ 172          
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|943974395|ref|XP_014368493.1| (PREDICTED: carbohydrate sulfotransferase 11 [Papilio machaon])

HSP 1 Score: 157.532 bits (397), Expect = 1.283e-45
Identity = 73/86 (84.88%), Postives = 78/86 (90.70%), Query Frame = 0
Query:    1 VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ 86
            VACTNWKRILMIL GKWN TDVL IPASLAH+PGMFRNLS+VPK +R  MLD+YHKMIIVRNPFERLLSAYRNKLEGD  SA+YFQ
Sbjct:   94 VACTNWKRILMILAGKWNGTDVLAIPASLAHTPGMFRNLSTVPKEDRQVMLDNYHKMIIVRNPFERLLSAYRNKLEGDTQSAKYFQ 179          
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|914559721|gb|KOB67255.1| (Chondroitin 4-sulfotransferase [Operophtera brumata])

HSP 1 Score: 154.451 bits (389), Expect = 1.005e-44
Identity = 70/80 (87.50%), Postives = 76/80 (95.00%), Query Frame = 0
Query:    1 VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLP 80
            VACTNWKRILMIL GKWNDTDVL IPASLAH+PG+FR LS+V KPERD+ML++YHKMIIVRNPFERLLSAYRNKLEGDLP
Sbjct:   87 VACTNWKRILMILAGKWNDTDVLAIPASLAHTPGLFRTLSTVEKPERDFMLENYHKMIIVRNPFERLLSAYRNKLEGDLP 166          
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|909561882|ref|XP_013136089.1| (PREDICTED: carbohydrate sulfotransferase 11 [Papilio polytes])

HSP 1 Score: 152.91 bits (385), Expect = 8.750e-44
Identity = 72/86 (83.72%), Postives = 77/86 (89.53%), Query Frame = 0
Query:    1 VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ 86
            VACTNWKRILMIL  KWN TDVL IPASLAHSPGMFRNLS+VPK +R  MLD+Y+KMIIVRNPFERLLSAYRNKLEGD  SA+YFQ
Sbjct:   92 VACTNWKRILMILASKWNGTDVLAIPASLAHSPGMFRNLSTVPKEDRQIMLDNYNKMIIVRNPFERLLSAYRNKLEGDTQSAKYFQ 177          
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|768446278|ref|XP_011565072.1| (PREDICTED: carbohydrate sulfotransferase 11-like [Plutella xylostella])

HSP 1 Score: 152.14 bits (383), Expect = 4.848e-43
Identity = 71/86 (82.56%), Postives = 78/86 (90.70%), Query Frame = 0
Query:    1 VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ 86
            VACTNWKR LMIL GKWN TDVL+IPA+L+HS GMFRNLSSVP  +RDYML++YHKMIIVRNPFERLLSAYRNKLEGD  SA+YFQ
Sbjct:  143 VACTNWKRTLMILEGKWNSTDVLSIPANLSHSMGMFRNLSSVPPEQRDYMLENYHKMIIVRNPFERLLSAYRNKLEGDSISAKYFQ 228          
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|768428781|ref|XP_011555542.1| (PREDICTED: carbohydrate sulfotransferase 11-like [Plutella xylostella])

HSP 1 Score: 150.599 bits (379), Expect = 7.360e-43
Identity = 71/86 (82.56%), Postives = 78/86 (90.70%), Query Frame = 0
Query:    1 VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ 86
            VACTNWKR LMIL GKWN TDVL+IPA+L+HS GMFRNLSSVP  +RDYML++YHKMIIVRNPFERLLSAYRNKLEGD  SA+YFQ
Sbjct:  101 VACTNWKRTLMILEGKWNSTDVLSIPANLSHSMGMFRNLSSVPPEQRDYMLENYHKMIIVRNPFERLLSAYRNKLEGDSISAKYFQ 186          
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|509164457|gb|JAA80349.1| (chondroitin 4-sulfotransferase, partial [Pararge aegeria])

HSP 1 Score: 143.28 bits (360), Expect = 2.155e-41
Identity = 66/76 (86.84%), Postives = 72/76 (94.74%), Query Frame = 0
Query:   11 MILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ 86
            MIL GKWNDTDVL++PASLAHSPGMFRNLS+V K ERD ML++YHKMIIVRNPFERLLSAYRNKLEGDLPSA+YFQ
Sbjct:    1 MILEGKWNDTDVLSVPASLAHSPGMFRNLSTVSKEERDVMLENYHKMIIVRNPFERLLSAYRNKLEGDLPSAKYFQ 76          
BLAST of OSCA025912-RA vs. genbank:protein
Match: gi|357629799|gb|EHJ78351.1| (chondroitin 4-sulfotransferase [Danaus plexippus])

HSP 1 Score: 144.821 bits (364), Expect = 9.899e-41
Identity = 65/86 (75.58%), Postives = 74/86 (86.05%), Query Frame = 0
Query:    1 VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYMLDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ 86
            VACTNWKRI MILTGKW++ D L+IPA LAHSPGMF+ L+ VP  +RD +LD+YHKMIIVRNPFERLLSAYRNKLEG   SA+YFQ
Sbjct:   85 VACTNWKRIFMILTGKWSNMDALSIPADLAHSPGMFKTLAMVPTEQRDIILDNYHKMIIVRNPFERLLSAYRNKLEGTYQSAKYFQ 170          
The following BLAST results are available for this feature:
BLAST of OSCA025912-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930652254|gb|KPI94594.1|3.763e-4686.05Carbohydrate sulfotransferase 11 [Papilio xuthus][more]
gi|910330383|ref|XP_013168487.1|6.819e-4686.05PREDICTED: carbohydrate sulfotransferase 11 [Papil... [more]
gi|930666454|gb|KPJ07570.1|9.185e-4684.88Carbohydrate sulfotransferase 11 [Papilio machaon][more]
gi|943974395|ref|XP_014368493.1|1.283e-4584.88PREDICTED: carbohydrate sulfotransferase 11 [Papil... [more]
gi|914559721|gb|KOB67255.1|1.005e-4487.50Chondroitin 4-sulfotransferase [Operophtera brumat... [more]
gi|909561882|ref|XP_013136089.1|8.750e-4483.72PREDICTED: carbohydrate sulfotransferase 11 [Papil... [more]
gi|768446278|ref|XP_011565072.1|4.848e-4382.56PREDICTED: carbohydrate sulfotransferase 11-like [... [more]
gi|768428781|ref|XP_011555542.1|7.360e-4382.56PREDICTED: carbohydrate sulfotransferase 11-like [... [more]
gi|509164457|gb|JAA80349.1|2.155e-4186.84chondroitin 4-sulfotransferase, partial [Pararge a... [more]
gi|357629799|gb|EHJ78351.1|9.899e-4175.58chondroitin 4-sulfotransferase [Danaus plexippus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016051 carbohydrate biosynthetic process
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0008146 sulfotransferase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005331SulfotransferasePFAMPF03567Sulfotransfer_2coord: 1..80
e-value: 4.3E-17
score: 62.5
IPR018011Carbohydrate sulfotransferase-relatedPANTHERPTHR12137CHONDROITIN 4-SULFOTRANSFERASEcoord: 1..86

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_29033contignewscf_29033:1124..1381 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025912-RAOSCA025912-RAOstrinia scapulalismRNAnewscf_29033 1124..1381 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025912-PA ID=OSCA025912-PA|Name=OSCA025912-RA|organism=Ostrinia scapulalis|type=polypeptide|length=86bp
VACTNWKRILMILTGKWNDTDVLNIPASLAHSPGMFRNLSSVPKPERDYM
LDSYHKMIIVRNPFERLLSAYRNKLEGDLPSARYFQ
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0016051carbohydrate biosynthetic process
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0008146sulfotransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR018011Carb_sulfotransferase-rel
IPR005331Sulfotransferase