OSCA025913-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025913-RA
Unique NameOSCA025913-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length63
Homology
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|913299209|ref|XP_013195450.1| (PREDICTED: solute carrier family 25 member 35-like isoform X1 [Amyelois transitella])

HSP 1 Score: 108.997 bits (271), Expect = 2.088e-27
Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = 0
Query:    1 VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIR 62
            VDSQNRG LY+GM DCFVKM+R EGA SL+KG+ ANY RLGPHTVLLLVCWDQLK LED +R
Sbjct:  249 VDSQNRGKLYNGMADCFVKMIRTEGAASLYKGLTANYLRLGPHTVLLLVCWDQLKMLEDYLR 310          
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|827556213|ref|XP_004930494.2| (PREDICTED: solute carrier family 25 member 35 [Bombyx mori])

HSP 1 Score: 108.997 bits (271), Expect = 2.440e-27
Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = 0
Query:    1 VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIR 62
            VD+ NRG LY GM DCFVKM+R+EGA SL+KGVGANY RLGPHTVLLLVCWDQLK LED +R
Sbjct:  250 VDANNRGRLYRGMIDCFVKMVRSEGASSLYKGVGANYMRLGPHTVLLLVCWDQLKILEDYLR 311          
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|909573479|ref|XP_013142399.1| (PREDICTED: solute carrier family 25 member 35-like [Papilio polytes])

HSP 1 Score: 103.219 bits (256), Expect = 3.754e-27
Identity = 46/63 (73.02%), Postives = 54/63 (85.71%), Query Frame = 0
Query:    1 VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIRS 63
            VDS N+G LY GM DCF+KMLR+EGA + +KGVGANY RLGPHTVLLLVCWDQLK LE+ ++S
Sbjct:   55 VDSNNKGTLYRGMADCFLKMLRSEGAGAFYKGVGANYLRLGPHTVLLLVCWDQLKILEEFLKS 117          
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|909580061|ref|XP_013145953.1| (PREDICTED: solute carrier family 25 member 35-like [Papilio polytes])

HSP 1 Score: 104.375 bits (259), Expect = 6.302e-27
Identity = 46/63 (73.02%), Postives = 55/63 (87.30%), Query Frame = 0
Query:    1 VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIRS 63
            VDS N+G LY GM+DCF+KMLR+EGA + +KGVGANY RLGPHTVLLLVCWDQLK LE+ ++S
Sbjct:  108 VDSNNKGTLYRGMSDCFLKMLRSEGAGAFYKGVGANYLRLGPHTVLLLVCWDQLKILEEFLKS 170          
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|1073530631|gb|JAT82427.1| (hypothetical protein g.11032, partial [Pectinophora gossypiella])

HSP 1 Score: 102.834 bits (255), Expect = 8.370e-27
Identity = 47/62 (75.81%), Postives = 53/62 (85.48%), Query Frame = 0
Query:    1 VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIR 62
            VD+QN+G LYSGM DCFVKM+R EG  SL+KGV ANY RLGPHTVLLLVCWDQLK LE+ +R
Sbjct:   73 VDAQNKGKLYSGMVDCFVKMIRTEGFLSLYKGVVANYMRLGPHTVLLLVCWDQLKILEEFLR 134          
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|943938586|ref|XP_014371005.1| (PREDICTED: solute carrier family 25 member 35-like isoform X2 [Papilio machaon] >gi|943938589|ref|XP_014371006.1| PREDICTED: solute carrier family 25 member 35-like isoform X2 [Papilio machaon] >gi|930679165|gb|KPJ19082.1| Solute carrier family 25 member 35 [Papilio machaon])

HSP 1 Score: 104.76 bits (260), Expect = 1.045e-25
Identity = 46/63 (73.02%), Postives = 55/63 (87.30%), Query Frame = 0
Query:    1 VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIRS 63
            VDS N+G LY GM+DCF+KML++EGA + +KGVGANY RLGPHTVLLLVCWDQLK LE+ +RS
Sbjct:  255 VDSNNKGTLYRGMSDCFLKMLKSEGAGAFYKGVGANYLRLGPHTVLLLVCWDQLKILEEFLRS 317          
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|910353488|ref|XP_013180752.1| (PREDICTED: solute carrier family 25 member 35-like isoform X1 [Papilio xuthus])

HSP 1 Score: 104.375 bits (259), Expect = 1.463e-25
Identity = 46/63 (73.02%), Postives = 55/63 (87.30%), Query Frame = 0
Query:    1 VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIRS 63
            VD+ N+G LY GM+DCF+KMLR+EGA + +KGVGANY RLGPHTVLLLVCWDQLK LE+ +RS
Sbjct:  251 VDNNNKGTLYRGMSDCFLKMLRSEGAGAFYKGVGANYLRLGPHTVLLLVCWDQLKILEEFLRS 313          
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|930663477|gb|KPJ05013.1| (Solute carrier family 25 member 35 [Papilio xuthus])

HSP 1 Score: 106.301 bits (264), Expect = 1.971e-25
Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 0
Query:    1 VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIRS 63
            VDS N+G LY GM+DCF+KMLR+EGA + +KGVGANY RLGPHTVLLLVCWDQLK LE+ +RS
Sbjct:  499 VDSNNKGTLYRGMSDCFLKMLRSEGAGAFYKGVGANYLRLGPHTVLLLVCWDQLKILEEFLRS 561          
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|768417811|ref|XP_011549563.1| (PREDICTED: solute carrier family 25 member 35-like isoform X1 [Plutella xylostella])

HSP 1 Score: 103.219 bits (256), Expect = 3.083e-25
Identity = 46/62 (74.19%), Postives = 52/62 (83.87%), Query Frame = 0
Query:    1 VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIR 62
            VD++NRG LYSGM DCFVK++R EG   L+KGVGANY RLGPHTVLLLVCWDQLK LE  +R
Sbjct:  252 VDARNRGTLYSGMVDCFVKIIRKEGVYGLYKGVGANYLRLGPHTVLLLVCWDQLKVLEQYLR 313          
BLAST of OSCA025913-RA vs. genbank:protein
Match: gi|914568320|gb|KOB72302.1| (Solute carrier family 25 member 35 [Operophtera brumata])

HSP 1 Score: 105.145 bits (261), Expect = 4.866e-25
Identity = 46/60 (76.67%), Postives = 53/60 (88.33%), Query Frame = 0
Query:    3 SQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVCWDQLKALEDRIR 62
            +QNRG LYSGM DCF+KM+R+EG  SL+KGVGANY RLGPHTVLLLVCWDQLK LE+ +R
Sbjct:  478 AQNRGTLYSGMVDCFLKMVRSEGVASLYKGVGANYMRLGPHTVLLLVCWDQLKILEEYLR 537          
The following BLAST results are available for this feature:
BLAST of OSCA025913-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913299209|ref|XP_013195450.1|2.088e-2779.03PREDICTED: solute carrier family 25 member 35-like... [more]
gi|827556213|ref|XP_004930494.2|2.440e-2779.03PREDICTED: solute carrier family 25 member 35 [Bom... [more]
gi|909573479|ref|XP_013142399.1|3.754e-2773.02PREDICTED: solute carrier family 25 member 35-like... [more]
gi|909580061|ref|XP_013145953.1|6.302e-2773.02PREDICTED: solute carrier family 25 member 35-like... [more]
gi|1073530631|gb|JAT82427.1|8.370e-2775.81hypothetical protein g.11032, partial [Pectinophor... [more]
gi|943938586|ref|XP_014371005.1|1.045e-2573.02PREDICTED: solute carrier family 25 member 35-like... [more]
gi|910353488|ref|XP_013180752.1|1.463e-2573.02PREDICTED: solute carrier family 25 member 35-like... [more]
gi|930663477|gb|KPJ05013.1|1.971e-2574.60Solute carrier family 25 member 35 [Papilio xuthus... [more]
gi|768417811|ref|XP_011549563.1|3.083e-2574.19PREDICTED: solute carrier family 25 member 35-like... [more]
gi|914568320|gb|KOB72302.1|4.866e-2576.67Solute carrier family 25 member 35 [Operophtera br... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006412 translation
biological_process GO:0006810 transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0003735 structural constituent of ribosome
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023395Mitochondrial carrier domainGENE3D1.50.40.10coord: 6..57
e-value: 2.0E-11
score: 42.6
IPR023395Mitochondrial carrier domainSUPERFAMILY103506Mitochondrial carriercoord: 5..54
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 5..56
e-value: 1.6E-9
score: 37.2
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 1..57
score: 14.211
NoneNo IPR availablePANTHERPTHR24089FAMILY NOT NAMEDcoord: 1..60
NoneNo IPR availablePANTHERPTHR24089:SF209SOLUTE CARRIER FAMILY 25 MEMBER 34coord: 1..60

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_27088contignewscf_27088:188..379 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025913-RAOSCA025913-RAOstrinia scapulalismRNAnewscf_27088 188..379 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025913-PA ID=OSCA025913-PA|Name=OSCA025913-RA|organism=Ostrinia scapulalis|type=polypeptide|length=63bp
VDSQNRGLLYSGMTDCFVKMLRAEGARSLFKGVGANYTRLGPHTVLLLVC
WDQLKALEDRIRS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006412translation
GO:0006810transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: INTERPRO
TermDefinition
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom