OSCA025915-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025915-RA
Unique NameOSCA025915-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length93
Homology
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|913311804|ref|XP_013186598.1| (PREDICTED: uncharacterized protein LOC106131883 isoform X1 [Amyelois transitella] >gi|913311806|ref|XP_013186599.1| PREDICTED: uncharacterized protein LOC106131883 isoform X2 [Amyelois transitella])

HSP 1 Score: 103.219 bits (256), Expect = 8.391e-24
Identity = 50/60 (83.33%), Postives = 53/60 (88.33%), Query Frame = 0
Query:   35 PKLSDEKLKEGIFAGPQVRELIKDSRFEEKLSDLEKSEWKDFKN-VANFLGKHKSDSYRE 93
            PK+SD K+KEGIF GPQ+RELIKDSRFEEKLSDLE S WK FKN VANFLG HKSDSYRE
Sbjct:  405 PKISDAKIKEGIFVGPQIRELIKDSRFEEKLSDLETSAWKAFKNVVANFLGNHKSDSYRE 464          
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|1009369395|gb|KYM94050.1| (hypothetical protein ALC62_15341, partial [Cyphomyrmex costatus])

HSP 1 Score: 79.7221 bits (195), Expect = 1.334e-15
Identity = 38/60 (63.33%), Postives = 48/60 (80.00%), Query Frame = 0
Query:   35 PKLSDEKLKEGIFAGPQVRELIKDSRFEEKLSDLEKSEWKDFKNVAN-FLGKHKSDSYRE 93
            PKLS+ K+KEGIF GPQ+RELIKD  F+ +L+ LEK+ WK FKNV N FLG HK+++Y E
Sbjct:  272 PKLSEAKIKEGIFVGPQIRELIKDEVFDSQLNTLEKNAWKCFKNVVNHFLGNHKAENYEE 331          
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|550251947|gb|JAB64762.1| (hypothetical protein, partial [Anoplophora glabripennis])

HSP 1 Score: 76.2554 bits (186), Expect = 2.407e-15
Identity = 35/60 (58.33%), Postives = 48/60 (80.00%), Query Frame = 0
Query:   35 PKLSDEKLKEGIFAGPQVRELIKDSRFEEKLSDLEKSEWKDFKNVA-NFLGKHKSDSYRE 93
            PKL++ K+KEGIF GPQ+R+L+KD+ FE KL+D EK  WK F NV  NFLG HK+++Y++
Sbjct:   43 PKLNEAKIKEGIFVGPQIRQLMKDTNFEGKLNDQEKVAWKCFVNVVQNFLGNHKAENYKD 102          
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|861614797|gb|KMQ85949.1| (hypothetical protein RF55_15223 [Lasius niger])

HSP 1 Score: 73.559 bits (179), Expect = 2.732e-13
Identity = 35/60 (58.33%), Postives = 43/60 (71.67%), Query Frame = 0
Query:   35 PKLSDEKLKEGIFAGPQVRELIKDSRFEEKLSDLEKSEWKDFKN-VANFLGKHKSDSYRE 93
            P +SD KLKEGIF GPQ+R L+KD  F  K++D+EK  W  FKN V NFLG H+S  Y+E
Sbjct:  345 PNISDAKLKEGIFNGPQIRTLLKDVIFVTKMNDVEKEAWLSFKNVVGNFLGNHRSPDYKE 404          
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|1058091410|gb|JAS49364.1| (hypothetical protein g.44900, partial [Cuerna arida])

HSP 1 Score: 68.9366 bits (167), Expect = 1.535e-12
Identity = 33/59 (55.93%), Postives = 42/59 (71.19%), Query Frame = 0
Query:   34 VPKLSDEKLKEGIFAGPQVRELIKDSRFEEKLSDLEKSEWKDFKNVA-NFLGKHKSDSY 91
            +P LS EKLK GIF GPQ+R+LIKD  F E +++LE+  WK F  V  NFLG HK+ +Y
Sbjct:  122 MPGLSTEKLKAGIFDGPQIRQLIKDPHFNESMNELEEKAWKSFVLVVQNFLGNHKAANY 180          
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|1048012130|ref|XP_017466963.1| (PREDICTED: uncharacterized protein LOC108359562 [Rhagoletis zephyria] >gi|1048067052|ref|XP_017486052.1| PREDICTED: uncharacterized protein LOC108374586 [Rhagoletis zephyria])

HSP 1 Score: 69.707 bits (169), Expect = 7.078e-12
Identity = 34/72 (47.22%), Postives = 49/72 (68.06%), Query Frame = 0
Query:   23 NSQPSTSGQCVVPKLSDEKLKEGIFAGPQVRELIKDSRFEEKLSDLEKSEWKDFKNVA-NFLGKHKSDSYRE 93
            NS+     + V PKLSD K+KEGIF GPQ+R+L+ D  F EKL+++EK  W  F ++  N+LG  +S +Y+E
Sbjct:  392 NSESFLHLETVFPKLSDAKIKEGIFIGPQIRKLMIDENFVEKLNEVEKRAWLSFISLCHNYLGNERSSNYKE 463          
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|828221616|ref|XP_012562008.1| (PREDICTED: uncharacterized protein LOC105847171 [Hydra vulgaris])

HSP 1 Score: 68.9366 bits (167), Expect = 8.142e-12
Identity = 36/71 (50.70%), Postives = 46/71 (64.79%), Query Frame = 0
Query:   30 GQCV------VPKLSDEKLKEGIFAGPQVRELIKDSRFEEKLSDLEKSEWKDFKNVA-NFLGKHKSDSYRE 93
            GQC        P LS EK+K GIF+GPQ+R++IKD +F   ++D+E S WK F  V  NFLG HKS +Y E
Sbjct:  155 GQCFKYICRFFPGLSMEKIKAGIFSGPQIRQIIKDEQFLYTMTDIEASAWKSFVLVLHNFLGNHKSPNYEE 225          
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|913331559|ref|XP_013197360.1| (PREDICTED: uncharacterized protein LOC106140328 [Amyelois transitella])

HSP 1 Score: 67.3958 bits (163), Expect = 3.711e-11
Identity = 35/71 (49.30%), Postives = 47/71 (66.20%), Query Frame = 0
Query:   29 SGQCV------VPKLSDEKLKEGIFAGPQVRELIKDS-RFEEKLSDLEKSEWKDFKNVA-NFLGKHKSDSY 91
            +GQC        P LS EKLK GIF GPQ+R+L+KD+  FE  +++LE+  WK F  V  NFLG HK+++Y
Sbjct:  396 NGQCFQFISRKFPGLSTEKLKAGIFDGPQIRQLMKDTANFETYMNELERLAWKSFVAVTRNFLGNHKAENY 466          
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|913318860|ref|XP_013190479.1| (PREDICTED: uncharacterized protein LOC106134883 [Amyelois transitella])

HSP 1 Score: 67.3958 bits (163), Expect = 4.417e-11
Identity = 35/71 (49.30%), Postives = 47/71 (66.20%), Query Frame = 0
Query:   29 SGQCV------VPKLSDEKLKEGIFAGPQVRELIKDS-RFEEKLSDLEKSEWKDFKNVA-NFLGKHKSDSY 91
            +GQC        P LS EKLK GIF GPQ+R+L+KD+  FE  +++LE+  WK F  V  NFLG HK+++Y
Sbjct:  333 NGQCFQFISRKFPGLSTEKLKAGIFDGPQIRQLMKDTANFETYMNELERLAWKSFVAVTRNFLGNHKAENY 403          
BLAST of OSCA025915-RA vs. genbank:protein
Match: gi|861604702|gb|KMQ84254.1| (hypothetical protein RF55_18104 [Lasius niger])

HSP 1 Score: 67.0106 bits (162), Expect = 4.865e-11
Identity = 33/71 (46.48%), Postives = 46/71 (64.79%), Query Frame = 0
Query:   30 GQCV------VPKLSDEKLKEGIFAGPQVRELIKDSRFEEKLSDLEKSEWKDFKNVA-NFLGKHKSDSYRE 93
            G+C        P++SD KLKEGIF GPQ+R+++K+  F + ++  EK+ W  FK V  NFLG HKSD Y +
Sbjct:  162 GKCFEYLGKEFPEISDAKLKEGIFDGPQIRKMLKNENFIKSMNQKEKAAWISFKKVVENFLGNHKSDDYEQ 232          
The following BLAST results are available for this feature:
BLAST of OSCA025915-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913311804|ref|XP_013186598.1|8.391e-2483.33PREDICTED: uncharacterized protein LOC106131883 is... [more]
gi|1009369395|gb|KYM94050.1|1.334e-1563.33hypothetical protein ALC62_15341, partial [Cyphomy... [more]
gi|550251947|gb|JAB64762.1|2.407e-1558.33hypothetical protein, partial [Anoplophora glabrip... [more]
gi|861614797|gb|KMQ85949.1|2.732e-1358.33hypothetical protein RF55_15223 [Lasius niger][more]
gi|1058091410|gb|JAS49364.1|1.535e-1255.93hypothetical protein g.44900, partial [Cuerna arid... [more]
gi|1048012130|ref|XP_017466963.1|7.078e-1247.22PREDICTED: uncharacterized protein LOC108359562 [R... [more]
gi|828221616|ref|XP_012562008.1|8.142e-1250.70PREDICTED: uncharacterized protein LOC105847171 [H... [more]
gi|913331559|ref|XP_013197360.1|3.711e-1149.30PREDICTED: uncharacterized protein LOC106140328 [A... [more]
gi|913318860|ref|XP_013190479.1|4.417e-1149.30PREDICTED: uncharacterized protein LOC106134883 [A... [more]
gi|861604702|gb|KMQ84254.1|4.865e-1146.48hypothetical protein RF55_18104 [Lasius niger][more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_30534contignewscf_30534:136..414 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025915-RAOSCA025915-RAOstrinia scapulalismRNAnewscf_30534 136..414 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025915-PA ID=OSCA025915-PA|Name=OSCA025915-RA|organism=Ostrinia scapulalis|type=polypeptide|length=93bp
QPHIVKKLPELIPVATTSVENDNSQPSTSGQCVVPKLSDEKLKEGIFAGP
QVRELIKDSRFEEKLSDLEKSEWKDFKNVANFLGKHKSDSYRE
back to top