OSCA025917-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025917-RA
Unique NameOSCA025917-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length79
Homology
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|357612130|gb|EHJ67822.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 75.8702 bits (185), Expect = 1.128e-15
Identity = 38/66 (57.58%), Postives = 49/66 (74.24%), Query Frame = 0
Query:   14 QTVCFTSDDIRLRNVASLIGLINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            +T CFT             GL+N+L+V QRAME+AML VSLRD++RN+EIR+RT+VTDIA+RIS L
Sbjct:   39 ETWCFTK------------GLMNRLRVVQRAMEKAMLAVSLRDRVRNDEIRRRTRVTDIAKRISSL 92          
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|357602605|gb|EHJ63466.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 75.8702 bits (185), Expect = 5.666e-15
Identity = 38/46 (82.61%), Postives = 43/46 (93.48%), Query Frame = 0
Query:   34 LINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            L+++LKVAQRAMERAMLGVSLRD+IRNE IR+RTKV DIA RISKL
Sbjct:  127 LVHQLKVAQRAMERAMLGVSLRDRIRNEVIRQRTKVIDIAHRISKL 172          
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|357629432|gb|EHJ78200.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 72.7886 bits (177), Expect = 1.244e-14
Identity = 37/46 (80.43%), Postives = 42/46 (91.30%), Query Frame = 0
Query:   34 LINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            L+ +LKVAQRAMERAMLGVSLRD+IRNE I++RTKV DIA RISKL
Sbjct:   14 LVLQLKVAQRAMERAMLGVSLRDRIRNEVIQQRTKVIDIAHRISKL 59          
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|357613373|gb|EHJ68466.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 73.9442 bits (180), Expect = 1.335e-14
Identity = 35/47 (74.47%), Postives = 44/47 (93.62%), Query Frame = 0
Query:   33 GLINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            GL+N+L+VAQRAMERAMLGVSL+D+IRN+ IR+RT+VTDIA+RIS  
Sbjct:   57 GLMNRLRVAQRAMERAMLGVSLQDRIRNDYIRRRTRVTDIAKRISSF 103          
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|298204341|gb|ADI61819.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 76.6406 bits (187), Expect = 1.491e-14
Identity = 37/48 (77.08%), Postives = 43/48 (89.58%), Query Frame = 0
Query:   32 IGLINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            +GL+ K KVAQRAMER MLGVSL D++RNEEIR+RTKVTDIA +ISKL
Sbjct:  866 VGLVRKFKVAQRAMERCMLGVSLMDRLRNEEIRQRTKVTDIALKISKL 913          
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 76.2554 bits (186), Expect = 1.884e-14
Identity = 37/48 (77.08%), Postives = 44/48 (91.67%), Query Frame = 0
Query:   32 IGLINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            +GL+ +LKV QRAMERAMLGVSLRDQIRNEEIR++T VTDIA+RI+ L
Sbjct:  866 MGLMRRLKVTQRAMERAMLGVSLRDQIRNEEIRRKTMVTDIAQRIATL 913          
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|357603461|gb|EHJ63790.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 73.1738 bits (178), Expect = 3.109e-14
Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 0
Query:   10 SASRQTVCFTSDDIRLRNVASLIGLINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            S   +  CFT             GL+ +L+VAQRAMERAM+GVSLRD+IRN+EIR+R K TDIA+RIS L
Sbjct:   60 SYGSEMWCFTK------------GLMKRLRVAQRAMERAMIGVSLRDRIRNDEIRRRMKGTDIAKRISSL 117          
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|357602606|gb|EHJ63467.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 71.2478 bits (173), Expect = 6.428e-14
Identity = 36/48 (75.00%), Postives = 43/48 (89.58%), Query Frame = 0
Query:   32 IGLINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            + L+++LKVAQRAMERAML VSLR++IRNE IR+RTKV DIA RISKL
Sbjct:   12 VRLVHQLKVAQRAMERAMLDVSLRERIRNEVIRQRTKVIDIAHRISKL 59          
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|357622103|gb|EHJ73704.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 74.3294 bits (181), Expect = 6.759e-14
Identity = 37/46 (80.43%), Postives = 43/46 (93.48%), Query Frame = 0
Query:   34 LINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            L+++LKVAQRAMERA+LGVSLRD+IRNE IR+RTKV DIA RISKL
Sbjct:  314 LVHQLKVAQRAMERAILGVSLRDRIRNEVIRQRTKVIDIAHRISKL 359          
BLAST of OSCA025917-RA vs. genbank:protein
Match: gi|357623427|gb|EHJ74581.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 74.3294 bits (181), Expect = 7.363e-14
Identity = 37/46 (80.43%), Postives = 43/46 (93.48%), Query Frame = 0
Query:   34 LINKLKVAQRAMERAMLGVSLRDQIRNEEIRKRTKVTDIARRISKL 79
            L+++LKVAQRA+ERAMLGVSLRD+IRNE IR+RTKV DIA RISKL
Sbjct:  398 LVHQLKVAQRAIERAMLGVSLRDRIRNEVIRQRTKVIDIAHRISKL 443          
The following BLAST results are available for this feature:
BLAST of OSCA025917-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357612130|gb|EHJ67822.1|1.128e-1557.58endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357602605|gb|EHJ63466.1|5.666e-1582.61endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357629432|gb|EHJ78200.1|1.244e-1480.43endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357613373|gb|EHJ68466.1|1.335e-1474.47endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204341|gb|ADI61819.1|1.491e-1477.08endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204337|gb|ADI61817.1|1.884e-1477.08endonuclease-reverse transcriptase [Bombyx mori][more]
gi|357603461|gb|EHJ63790.1|3.109e-1455.71endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357602606|gb|EHJ63467.1|6.428e-1475.00endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357622103|gb|EHJ73704.1|6.759e-1480.43endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357623427|gb|EHJ74581.1|7.363e-1480.43endonuclease-reverse transcriptase [Danaus plexipp... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0043551 regulation of phosphatidylinositol 3-kinase activity
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
cellular_component GO:0005942 phosphatidylinositol 3-kinase complex
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0016301 kinase activity
molecular_function GO:0035014 phosphatidylinositol 3-kinase regulator activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_40735contignewscf_40735:700..936 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025917-RAOSCA025917-RAOstrinia scapulalismRNAnewscf_40735 700..936 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025917-PA ID=OSCA025917-PA|Name=OSCA025917-RA|organism=Ostrinia scapulalis|type=polypeptide|length=79bp
MSPYFLGPTSASRQTVCFTSDDIRLRNVASLIGLINKLKVAQRAMERAML
GVSLRDQIRNEEIRKRTKVTDIARRISKL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016301kinase activity
GO:0035014phosphatidylinositol 3-kinase regulator activity
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0043551regulation of phosphatidylinositol 3-kinase activity
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Cellular Component
TermDefinition
GO:0005942phosphatidylinositol 3-kinase complex