OSCA025918-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025918-RA
Unique NameOSCA025918-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length188
Homology
BLAST of OSCA025918-RA vs. genbank:protein
Match: gi|930674699|gb|KPJ15030.1| (hypothetical protein RR48_09057 [Papilio machaon])

HSP 1 Score: 75.8702 bits (185), Expect = 1.031e-14
Identity = 61/72 (84.72%), Postives = 63/72 (87.50%), Query Frame = 0
Query:   57 MSDVGTLAAMDAFAGGARRRPARLPPPPPFVPPPPPQR--HDHYYVRRKSPIPRHAANLTLFARKNGTLTRN 126
            M DVGTLAAMDAFAGGARRRPARLPPPPPFVPPPPPQR  HDHYYVRRKSP+PRHA  L LFAR NGTL  +
Sbjct:    1 MGDVGTLAAMDAFAGGARRRPARLPPPPPFVPPPPPQRHDHDHYYVRRKSPVPRHANTLALFARTNGTLMHD 72          
BLAST of OSCA025918-RA vs. genbank:protein
Match: gi|930659777|gb|KPJ01822.1| (Phosphatase and actin regulator 1 [Papilio xuthus])

HSP 1 Score: 74.3294 bits (181), Expect = 2.750e-12
Identity = 61/69 (88.41%), Postives = 62/69 (89.86%), Query Frame = 0
Query:   57 MSDVGTLAAMDAFAGGARRRPARLPPPPPFVPPPPPQR--HDHYYVRRKSPIPRHAANLTLFARKNGTL 123
            M DVGTLAAMDAFAGGARRRPARLPPPPPFVPPPPPQR  HDHYYVRRKSP+PRHA  L LFAR NGTL
Sbjct:    1 MGDVGTLAAMDAFAGGARRRPARLPPPPPFVPPPPPQRHDHDHYYVRRKSPVPRHANTLALFARTNGTL 69          
The following BLAST results are available for this feature:
BLAST of OSCA025918-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 2
Match NameE-valueIdentityDescription
gi|930674699|gb|KPJ15030.1|1.031e-1484.72hypothetical protein RR48_09057 [Papilio machaon][more]
gi|930659777|gb|KPJ01822.1|2.750e-1288.41Phosphatase and actin regulator 1 [Papilio xuthus][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_12524contignewscf_12524:3040..3606 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025918-RAOSCA025918-RAOstrinia scapulalismRNAnewscf_12524 3040..3606 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025918-PA ID=OSCA025918-PA|Name=OSCA025918-RA|organism=Ostrinia scapulalis|type=polypeptide|length=188bp
MNGDKLKIQNKARRRVGGRMANAEGGRRSKSARGAGAGGRRNDRGRPQSS
SERAASMSDVGTLAAMDAFAGGARRRPARLPPPPPFVPPPPPQRHDHYYV
RRKSPIPRHAANLTLFARKNGTLTRNHALALPSHARSADAGRVSSSPART
RRHAIRNVNVTLSXISSLHVHHFQSLPGNFCAVSHSLD
back to top