OSCA025919-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025919-RA
Unique NameOSCA025919-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length289
Homology
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|910317846|ref|XP_013161719.1| (PREDICTED: ceramide phosphoethanolamine synthase [Papilio xuthus])

HSP 1 Score: 499.975 bits (1286), Expect = 2.942e-176
Identity = 230/284 (80.99%), Postives = 259/284 (91.20%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTS 284
            MVDHINHYIYGPL AIVD+ L IS+ +LFITPN+ISFFHV VA +G KL+TCQNLA RR+ +VLFQ+RMFLDDLDGHVAR  KHIKGERSEVGTLGYWVDG+CDL+GVIAMM GI++YLKNNPPRRGYKGTPVSTLPYHQLKEIN+SEDIEK+HT  E+GISYKTKV+FQRIVQVLGLFSGQM+LSS+AWNRYID+YQD+LENCTEYDVF+R   FKSG FF AT LWR+VNPHSYLHLLSLAVFCDKTW FLK VHY+GY+ LV+AV TSEYLVE+IR++V S
Sbjct:   85 MVDHINHYIYGPLCAIVDIGLGISETMLFITPNIISFFHVFVACVGAKLITCQNLAVRRLAVVLFQLRMFLDDLDGHVARERKHIKGERSEVGTLGYWVDGICDLLGVIAMMVGILLYLKNNPPRRGYKGTPVSTLPYHQLKEINTSEDIEKEHT-TEVGISYKTKVSFQRIVQVLGLFSGQMMLSSIAWNRYIDVYQDLLENCTEYDVFRRATMFKSGLFFFATALWRIVNPHSYLHLLSLAVFCDKTWGFLKTVHYSGYICLVIAVATSEYLVENIRSYVVS 367          
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|943953514|ref|XP_014359652.1| (PREDICTED: ceramide phosphoethanolamine synthase [Papilio machaon])

HSP 1 Score: 497.278 bits (1279), Expect = 3.585e-175
Identity = 230/284 (80.99%), Postives = 258/284 (90.85%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTS 284
            MVDHINHYIYGPL AIVD+ L IS+ +LFITPN+ISFFHV VA +G KLLTCQNLA RR+ +VLFQ+RMFLDDLDGHVAR  KHIKGERSEVGTLGYWVDG+CDL+GVIAMM GI++YLKNNPPRRGYKGTPVSTLPYHQLKEIN+SEDIEK+HT  E+GISYKTKV+FQRIVQVLGLFSGQM+LSS+AWNRYID+YQD+LENCT+YDV +R   FKSG FF AT LWRVVNPHSYLHLLSLAVFCDKTW FLK VHY+GY+ LV+AV TSEYLVE+IR++V S
Sbjct:   86 MVDHINHYIYGPLCAIVDIGLGISENMLFITPNIISFFHVFVACVGAKLLTCQNLALRRLAVVLFQLRMFLDDLDGHVARERKHIKGERSEVGTLGYWVDGICDLLGVIAMMIGILLYLKNNPPRRGYKGTPVSTLPYHQLKEINTSEDIEKEHT-TEVGISYKTKVSFQRIVQVLGLFSGQMMLSSIAWNRYIDVYQDLLENCTQYDVIRRATMFKSGLFFFATALWRVVNPHSYLHLLSLAVFCDKTWSFLKTVHYSGYICLVIAVATSEYLVENIRSYVVS 368          
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|909579503|ref|XP_013145650.1| (PREDICTED: ceramide phosphoethanolamine synthase [Papilio polytes])

HSP 1 Score: 496.893 bits (1278), Expect = 3.956e-175
Identity = 231/284 (81.34%), Postives = 257/284 (90.49%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTS 284
            MVDHINHYIYGPL AIVD+ L IS+ +LFITPNMISFFHV VA +G KL+T QNLAARR+ +VLFQ+RMFLDDLDGHVAR  KHIKGERSEVGTLGYWVDG+CDL+GV+AMM GI+ YLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHT  E+GISYKTKV+FQRIVQVLGLFSGQM+LSS+AWNRYID+YQD+LENCTEYDV +R   F+SG FF AT LWRVVNPHSYLHLLSLAVFCDKTW FLK VHY+GY+ LV+AV TSEYLVE+IR++V S
Sbjct:   86 MVDHINHYIYGPLCAIVDIGLGISETVLFITPNMISFFHVFVACVGAKLVTYQNLAARRLAVVLFQLRMFLDDLDGHVARERKHIKGERSEVGTLGYWVDGICDLLGVVAMMAGILFYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHT-TEVGISYKTKVSFQRIVQVLGLFSGQMILSSIAWNRYIDVYQDLLENCTEYDVVRRATMFRSGLFFFATALWRVVNPHSYLHLLSLAVFCDKTWGFLKTVHYSGYICLVIAVATSEYLVENIRSYVVS 368          
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|913322772|ref|XP_013192622.1| (PREDICTED: ceramide phosphoethanolamine synthase [Amyelois transitella])

HSP 1 Score: 492.656 bits (1267), Expect = 2.333e-173
Identity = 229/285 (80.35%), Postives = 259/285 (90.88%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTSG 285
            MVDHINHYIY PL +++D+ L+IS+ LLF+TPNMISF HV++A IG KLLTCQNLAARR+ IVLFQIRMFLDDLDGHVAR  KHIKGERSEVGT+GYWVDG+CD++GVIAMM GI++YLKNNPPRRGYKGT V++LPYHQLKEINSSEDIEKDHT  EIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQ++LEN  EYD+ +R+A FKSG FF AT LWRVVNPHSYLHLLSLAVFCDKTW FLK VHY+GY+ LV+ VGTSEYLV++IR+FV +G
Sbjct:   84 MVDHINHYIYAPLCSMLDLGLKISENLLFLTPNMISFSHVIIACIGAKLLTCQNLAARRIAIVLFQIRMFLDDLDGHVARERKHIKGERSEVGTMGYWVDGLCDMLGVIAMMVGILLYLKNNPPRRGYKGTSVTSLPYHQLKEINSSEDIEKDHT-TEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQELLENSAEYDILRRQAAFKSGIFFSATSLWRVVNPHSYLHLLSLAVFCDKTWGFLKIVHYSGYVCLVITVGTSEYLVQNIRSFVLNG 367          
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|930660014|gb|KPJ02043.1| (Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 [Papilio xuthus])

HSP 1 Score: 499.59 bits (1285), Expect = 3.556e-173
Identity = 229/282 (81.21%), Postives = 258/282 (91.49%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFV 282
            MVDHINHYIYGPL AIVD+ L IS+ +LFITPN+ISFFHV VA +G KL+TCQNLA RR+ +VLFQ+RMFLDDLDGHVAR  KHIKGERSEVGTLGYWVDG+CDL+GVIAMM GI++YLKNNPPRRGYKGTPVSTLPYHQLKEIN+SEDIEK+HT  E+GISYKTKV+FQRIVQVLGLFSGQM+LSS+AWNRYID+YQD+LENCTEYDVF+R   FKSG FF AT LWR+VNPHSYLHLLSLAVFCDKTW FLK VHY+GY+ LV+AV TSEYLVE+IR++V
Sbjct:  150 MVDHINHYIYGPLCAIVDIGLGISETMLFITPNIISFFHVFVACVGAKLITCQNLAVRRLAVVLFQLRMFLDDLDGHVARERKHIKGERSEVGTLGYWVDGICDLLGVIAMMVGILLYLKNNPPRRGYKGTPVSTLPYHQLKEINTSEDIEKEHT-TEVGISYKTKVSFQRIVQVLGLFSGQMMLSSIAWNRYIDVYQDLLENCTEYDVFRRATMFKSGLFFFATALWRIVNPHSYLHLLSLAVFCDKTWGFLKTVHYSGYICLVIAVATSEYLVENIRSYV 430          
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|913333547|ref|XP_013198451.1| (PREDICTED: ceramide phosphoethanolamine synthase-like [Amyelois transitella])

HSP 1 Score: 492.271 bits (1266), Expect = 1.411e-171
Identity = 229/285 (80.35%), Postives = 259/285 (90.88%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTSG 285
            MVDHINHYIY PL +++D+ L+IS+ LLF+TPNMISF HV++A IG KLLTCQNLAARR+ IVLFQIRMFLDDLDGHVAR  KHIKGERSEVGT+GYWVDG+CD++GVIAMM GI++YLKNNPPRRGYKGT V++LPYHQLKEINSSEDIEKDHT  EIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQ++LEN  EYD+ +R+A FKSG FF AT LWRVVNPHSYLHLLSLAVFCDKTW FLK VHY+GY+ LV+ VGTSEYLV++IR+FV +G
Sbjct:  195 MVDHINHYIYAPLCSMLDLGLKISENLLFLTPNMISFSHVIIACIGAKLLTCQNLAARRIAIVLFQIRMFLDDLDGHVARERKHIKGERSEVGTMGYWVDGLCDMLGVIAMMVGILLYLKNNPPRRGYKGTSVTSLPYHQLKEINSSEDIEKDHT-TEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQELLENSAEYDILRRQAAFKSGIFFSATSLWRVVNPHSYLHLLSLAVFCDKTWGFLKIVHYSGYVCLVITVGTSEYLVQNIRSFVLNG 478          
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|930673734|gb|KPJ14168.1| (putative ATP-dependent RNA helicase DHX35 [Papilio machaon])

HSP 1 Score: 504.597 bits (1298), Expect = 3.472e-171
Identity = 230/284 (80.99%), Postives = 258/284 (90.85%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTS 284
            MVDHINHYIYGPL AIVD+ L IS+ +LFITPN+ISFFHV VA +G KLLTCQNLA RR+ +VLFQ+RMFLDDLDGHVAR  KHIKGERSEVGTLGYWVDG+CDL+GVIAMM GI++YLKNNPPRRGYKGTPVSTLPYHQLKEIN+SEDIEK+HT  E+GISYKTKV+FQRIVQVLGLFSGQM+LSS+AWNRYID+YQD+LENCT+YDV +R   FKSG FF AT LWRVVNPHSYLHLLSLAVFCDKTW FLK VHY+GY+ LV+AV TSEYLVE+IR++V S
Sbjct:  579 MVDHINHYIYGPLCAIVDIGLGISENMLFITPNIISFFHVFVACVGAKLLTCQNLALRRLAVVLFQLRMFLDDLDGHVARERKHIKGERSEVGTLGYWVDGICDLLGVIAMMIGILLYLKNNPPRRGYKGTPVSTLPYHQLKEINTSEDIEKEHT-TEVGISYKTKVSFQRIVQVLGLFSGQMMLSSIAWNRYIDVYQDLLENCTQYDVIRRATMFKSGLFFFATALWRVVNPHSYLHLLSLAVFCDKTWSFLKTVHYSGYICLVIAVATSEYLVENIRSYVVS 861          
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|357605091|gb|EHJ64461.1| (hypothetical protein KGM_06450 [Danaus plexippus])

HSP 1 Score: 492.656 bits (1267), Expect = 1.491e-160
Identity = 220/287 (76.66%), Postives = 255/287 (88.85%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTSGVD 287
            MVDH+NHYIYGPL +++D+ L IS+++LFITPNMIS FHV +A +G KLLTCQ+L ARR+ +VLFQ+RMFLDDLDGHVAR  KHIKGERSEVGTLGYWVDG+CDL+GV+AMM GI+IYLKNNPPRRGYKGTPVSTLPYHQLKEINS+EDIEK++   EIGISYKTKVTFQRI QV+GLFSGQM+LSSLAWNRYID+YQD+LEN TEYDV +RE+TF+SG FF AT LWR+VNPHSYLHLLSL+VFCDKTW FL+ VHY GY  LV+ V  SEYLV++IRT V +G D
Sbjct: 1177 MVDHVNHYIYGPLCSLLDIGLGISERILFITPNMISIFHVFIACVGAKLLTCQSLVARRIAVVLFQMRMFLDDLDGHVARERKHIKGERSEVGTLGYWVDGLCDLLGVVAMMLGILIYLKNNPPRRGYKGTPVSTLPYHQLKEINSNEDIEKENV--EIGISYKTKVTFQRIAQVIGLFSGQMLLSSLAWNRYIDLYQDILENSTEYDVLRRESTFRSGIFFSATSLWRIVNPHSYLHLLSLSVFCDKTWPFLRTVHYAGYGCLVITVAISEYLVQNIRTSVITGND 1461          
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|768443523|ref|XP_011563581.1| (PREDICTED: ceramide phosphoethanolamine synthase [Plutella xylostella])

HSP 1 Score: 422.935 bits (1086), Expect = 9.067e-146
Identity = 191/287 (66.55%), Postives = 232/287 (80.84%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTSGVD 287
            M+D  NHYIYGPL AI D+S  +S+ +LFITPNMIS FHV +A+I GKL T Q+LAARRV +VL+QIR  LDDLDGHVAR  KHIKGERSEVGTLGYWVDG CD+IGV+AM+ GI  YLKNNPPR+GY+G  VSTLPYHQLKE+N+ ED++KD   +E+GISYKTKV+F +I QV+  FSGQ++LSSL WNRY+D+YQ++LENC  +DV KR+  F+S  FF AT  WR++NPHSYLHLL LAVFCDKTW FLK VH++GY+ L+ AV  SEY +   R FV+SG D
Sbjct:   85 MIDSTNHYIYGPLCAIFDISTGLSENMLFITPNMISIFHVFIALIAGKLFTFQSLAARRVAVVLYQIRTILDDLDGHVARERKHIKGERSEVGTLGYWVDGFCDMIGVVAMIVGITFYLKNNPPRKGYRGASVSTLPYHQLKEMNTLEDMDKD--GSEVGISYKTKVSFPKIAQVVCWFSGQLLLSSLMWNRYVDVYQELLENCVNFDVMKRQEVFRSSIFFTATSFWRLLNPHSYLHLLCLAVFCDKTWIFLKMVHHSGYVCLLFAVAISEYFIAQFRLFVSSGAD 369          
BLAST of OSCA025919-RA vs. genbank:protein
Match: gi|512893525|ref|XP_004923203.1| (PREDICTED: ceramide phosphoethanolamine synthase [Bombyx mori])

HSP 1 Score: 405.601 bits (1041), Expect = 5.771e-139
Identity = 189/287 (65.85%), Postives = 235/287 (81.88%), Query Frame = 0
Query:    1 MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLLTCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVDGVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDIEKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDVLENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTWCFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTSGVD 287
            MVDHINHYIYGPL AI+D +LRISD++LF+TPN IS  HV +A+IG  LLTC NL+ RR+GIVLFQIRMFLDDLDGHVAR  KHI+GERSEVG+LGYWVDG+CDLIGV+AMM GI +Y K  PPRRGY+GT  S LPY+QLKE+N++E++EKDH A+++GISYKTKV+ + I+QV+ LFSGQMVLSS+AWNRYI++YQ++ EN   Y +  R  TF+S  FF ATL+WR++NPHSYLH+LSLAVF DKTW  LK+V Y GY+ L++AV  +EYL+      V + VD
Sbjct:   85 MVDHINHYIYGPLCAILDKALRISDRMLFLTPNTISCAHVFIAMIGANLLTCPNLSVRRMGIVLFQIRMFLDDLDGHVARERKHIRGERSEVGSLGYWVDGICDLIGVVAMMLGIFVYFKQYPPRRGYRGTSASALPYYQLKEMNAAENMEKDH-ASDVGISYKTKVSLKAIIQVIILFSGQMVLSSVAWNRYINVYQEMFENGNGY-LAGRLVTFRSVRFFCATLMWRILNPHSYLHVLSLAVFIDKTWSLLKSVRYIGYVLLLLAVFVTEYLISGFEASVKTSVD 369          
The following BLAST results are available for this feature:
BLAST of OSCA025919-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910317846|ref|XP_013161719.1|2.942e-17680.99PREDICTED: ceramide phosphoethanolamine synthase [... [more]
gi|943953514|ref|XP_014359652.1|3.585e-17580.99PREDICTED: ceramide phosphoethanolamine synthase [... [more]
gi|909579503|ref|XP_013145650.1|3.956e-17581.34PREDICTED: ceramide phosphoethanolamine synthase [... [more]
gi|913322772|ref|XP_013192622.1|2.333e-17380.35PREDICTED: ceramide phosphoethanolamine synthase [... [more]
gi|930660014|gb|KPJ02043.1|3.556e-17381.21Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
gi|913333547|ref|XP_013198451.1|1.411e-17180.35PREDICTED: ceramide phosphoethanolamine synthase-l... [more]
gi|930673734|gb|KPJ14168.1|3.472e-17180.99putative ATP-dependent RNA helicase DHX35 [Papilio... [more]
gi|357605091|gb|EHJ64461.1|1.491e-16076.66hypothetical protein KGM_06450 [Danaus plexippus][more]
gi|768443523|ref|XP_011563581.1|9.067e-14666.55PREDICTED: ceramide phosphoethanolamine synthase [... [more]
gi|512893525|ref|XP_004923203.1|5.771e-13965.85PREDICTED: ceramide phosphoethanolamine synthase [... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008654 phospholipid biosynthetic process
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0016020 membrane
molecular_function GO:0005524 ATP binding
molecular_function GO:0008026 ATP-dependent helicase activity
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0016780 phosphotransferase activity, for other substituted phosphate groups
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000462CDP-alcohol phosphatidyltransferasePFAMPF01066CDP-OH_P_transfcoord: 29..119
e-value: 6.6E-10
score: 39.0
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 47..96
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 120..289
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..26
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 97..119
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 27..46
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 28..50

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_8835contignewscf_8835:4437..5306 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025919-RAOSCA025919-RAOstrinia scapulalismRNAnewscf_8835 4437..5306 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025919-PA ID=OSCA025919-PA|Name=OSCA025919-RA|organism=Ostrinia scapulalis|type=polypeptide|length=289bp
MVDHINHYIYGPLSAIVDVSLRISDKLLFITPNMISFFHVLVAIIGGKLL
TCQNLAARRVGIVLFQIRMFLDDLDGHVARXXKHIKGERSEVGTLGYWVD
GVCDLIGVIAMMTGIVIYLKNNPPRRGYKGTPVSTLPYHQLKEINSSEDI
EKDHTAAEIGISYKTKVTFQRIVQVLGLFSGQMVLSSLAWNRYIDIYQDV
LENCTEYDVFKREATFKSGTFFMATLLWRVVNPHSYLHLLSLAVFCDKTW
CFLKAVHYTGYLALVVAVGTSEYLVESIRTFVTSGVDSS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0008026ATP-dependent helicase activity
GO:0016780phosphotransferase activity, for other substituted phosphate groups
Vocabulary: Biological Process
TermDefinition
GO:0008654phospholipid biosynthetic process
Vocabulary: INTERPRO
TermDefinition
IPR000462CDP-OH_P_trans