OSCA025920-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025920-RA
Unique NameOSCA025920-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length125
Homology
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|913323444|ref|XP_013192989.1| (PREDICTED: dedicator of cytokinesis protein 7 [Amyelois transitella])

HSP 1 Score: 125.946 bits (315), Expect = 4.672e-31
Identity = 58/62 (93.55%), Postives = 61/62 (98.39%), Query Frame = 0
Query:   29 RYGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            RYGKNSRLTQSLNNSLAFFLFDLLS+MDRGYVF LIRSYYKQMSAKIASLPDAVPLVHYK++
Sbjct:  968 RYGKNSRLTQSLNNSLAFFLFDLLSVMDRGYVFNLIRSYYKQMSAKIASLPDAVPLVHYKLA 1029          
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|357614411|gb|EHJ69065.1| (hypothetical protein KGM_16907 [Danaus plexippus])

HSP 1 Score: 121.709 bits (304), Expect = 1.227e-29
Identity = 56/62 (90.32%), Postives = 60/62 (96.77%), Query Frame = 0
Query:   29 RYGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            +YGKNSRLTQSLNNSLAFFLFDLLSIMDRG+VF LIR Y+KQMSAKIASLPDAVPLVHYK+S
Sbjct:  948 KYGKNSRLTQSLNNSLAFFLFDLLSIMDRGFVFTLIRGYHKQMSAKIASLPDAVPLVHYKLS 1009          
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|827553293|ref|XP_012548345.1| (PREDICTED: dedicator of cytokinesis protein 7 [Bombyx mori])

HSP 1 Score: 120.553 bits (301), Expect = 3.271e-29
Identity = 55/61 (90.16%), Postives = 59/61 (96.72%), Query Frame = 0
Query:   30 YGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            YGKNSRLTQSLNNSLAFFLFDL++IMDRGYV  L+R+YYKQMSAKIASLPDAVPLVHYKVS
Sbjct:  969 YGKNSRLTQSLNNSLAFFLFDLINIMDRGYVLSLVRTYYKQMSAKIASLPDAVPLVHYKVS 1029          
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|909582266|ref|XP_013147155.1| (PREDICTED: dedicator of cytokinesis protein 7 isoform X3 [Papilio polytes])

HSP 1 Score: 116.701 bits (291), Expect = 7.143e-28
Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
Query:   30 YGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            YG NSRLTQSLNNSLAFFLFDLLS+MDRGYV  L+R Y+KQMSAKIASLPDAVPLVHYK+S
Sbjct:  933 YGSNSRLTQSLNNSLAFFLFDLLSVMDRGYVLALVRGYHKQMSAKIASLPDAVPLVHYKLS 993          
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|909582264|ref|XP_013147154.1| (PREDICTED: dedicator of cytokinesis protein 7 isoform X2 [Papilio polytes])

HSP 1 Score: 116.701 bits (291), Expect = 7.148e-28
Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
Query:   30 YGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            YG NSRLTQSLNNSLAFFLFDLLS+MDRGYV  L+R Y+KQMSAKIASLPDAVPLVHYK+S
Sbjct:  973 YGSNSRLTQSLNNSLAFFLFDLLSVMDRGYVLALVRGYHKQMSAKIASLPDAVPLVHYKLS 1033          
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|909582262|ref|XP_013147153.1| (PREDICTED: dedicator of cytokinesis protein 7 isoform X1 [Papilio polytes])

HSP 1 Score: 116.701 bits (291), Expect = 7.149e-28
Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
Query:   30 YGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            YG NSRLTQSLNNSLAFFLFDLLS+MDRGYV  L+R Y+KQMSAKIASLPDAVPLVHYK+S
Sbjct:  974 YGSNSRLTQSLNNSLAFFLFDLLSVMDRGYVLALVRGYHKQMSAKIASLPDAVPLVHYKLS 1034          
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|943955874|ref|XP_014360861.1| (PREDICTED: dedicator of cytokinesis protein 7 [Papilio machaon])

HSP 1 Score: 116.316 bits (290), Expect = 1.115e-27
Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
Query:   30 YGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            YG NSRLTQSLNNSLAFFLFDLLS+MDRGYV  LIR Y+KQMSAKIASLPDAVPLVHYK++
Sbjct:  927 YGSNSRLTQSLNNSLAFFLFDLLSVMDRGYVLALIRGYHKQMSAKIASLPDAVPLVHYKLA 987          
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|930672669|gb|KPJ13246.1| (Dedicator of cytokinesis protein 6 [Papilio machaon])

HSP 1 Score: 116.316 bits (290), Expect = 1.116e-27
Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
Query:   30 YGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            YG NSRLTQSLNNSLAFFLFDLLS+MDRGYV  LIR Y+KQMSAKIASLPDAVPLVHYK++
Sbjct:  974 YGSNSRLTQSLNNSLAFFLFDLLSVMDRGYVLALIRGYHKQMSAKIASLPDAVPLVHYKLA 1034          
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|910355063|ref|XP_013181339.1| (PREDICTED: dedicator of cytokinesis protein 7 isoform X2 [Papilio xuthus])

HSP 1 Score: 115.546 bits (288), Expect = 1.830e-27
Identity = 52/61 (85.25%), Postives = 57/61 (93.44%), Query Frame = 0
Query:   30 YGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            YG NSRLTQSLNNSLAFFLFDLLS+MDRGYV  L+R Y+KQMSAKIASLPDAVPLVHYK++
Sbjct:  934 YGSNSRLTQSLNNSLAFFLFDLLSVMDRGYVLALVRGYHKQMSAKIASLPDAVPLVHYKLA 994          
BLAST of OSCA025920-RA vs. genbank:protein
Match: gi|910355061|ref|XP_013181338.1| (PREDICTED: dedicator of cytokinesis protein 7 isoform X1 [Papilio xuthus])

HSP 1 Score: 115.546 bits (288), Expect = 1.832e-27
Identity = 52/61 (85.25%), Postives = 57/61 (93.44%), Query Frame = 0
Query:   30 YGKNSRLTQSLNNSLAFFLFDLLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVS 90
            YG NSRLTQSLNNSLAFFLFDLLS+MDRGYV  L+R Y+KQMSAKIASLPDAVPLVHYK++
Sbjct:  975 YGSNSRLTQSLNNSLAFFLFDLLSVMDRGYVLALVRGYHKQMSAKIASLPDAVPLVHYKLA 1035          
The following BLAST results are available for this feature:
BLAST of OSCA025920-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913323444|ref|XP_013192989.1|4.672e-3193.55PREDICTED: dedicator of cytokinesis protein 7 [Amy... [more]
gi|357614411|gb|EHJ69065.1|1.227e-2990.32hypothetical protein KGM_16907 [Danaus plexippus][more]
gi|827553293|ref|XP_012548345.1|3.271e-2990.16PREDICTED: dedicator of cytokinesis protein 7 [Bom... [more]
gi|909582266|ref|XP_013147155.1|7.143e-2886.89PREDICTED: dedicator of cytokinesis protein 7 isof... [more]
gi|909582264|ref|XP_013147154.1|7.148e-2886.89PREDICTED: dedicator of cytokinesis protein 7 isof... [more]
gi|909582262|ref|XP_013147153.1|7.149e-2886.89PREDICTED: dedicator of cytokinesis protein 7 isof... [more]
gi|943955874|ref|XP_014360861.1|1.115e-2786.89PREDICTED: dedicator of cytokinesis protein 7 [Pap... [more]
gi|930672669|gb|KPJ13246.1|1.116e-2786.89Dedicator of cytokinesis protein 6 [Papilio machao... [more]
gi|910355063|ref|XP_013181339.1|1.830e-2785.25PREDICTED: dedicator of cytokinesis protein 7 isof... [more]
gi|910355061|ref|XP_013181338.1|1.832e-2785.25PREDICTED: dedicator of cytokinesis protein 7 isof... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0043547 positive regulation of GTPase activity
biological_process GO:0007264 small GTPase mediated signal transduction
cellular_component GO:0005622 intracellular
molecular_function GO:0005085 guanyl-nucleotide exchange factor activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026798Dedicator of cytokinesis 6PANTHERPTHR23317:SF65DEDICATOR OF CYTOKINESIS PROTEIN 6coord: 32..85
IPR026791Dedicator of cytokinesisPANTHERPTHR23317DEDICATOR OF CYTOKINESIS (DOCK)coord: 32..85
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..43
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 65..125
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 44..64

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_48230contignewscf_48230:656..1033 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025920-RAOSCA025920-RAOstrinia scapulalismRNAnewscf_48230 656..1033 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025920-PA ID=OSCA025920-PA|Name=OSCA025920-RA|organism=Ostrinia scapulalis|type=polypeptide|length=125bp
MITDFCSNYEYLVIELLVSEESITISFFRYGKNSRLTQSLNNSLAFFLFD
LLSIMDRGYVFLLIRSYYKQMSAKIASLPDAVPLVHYKVSETLNIWIDVK
TMPEIGVFFFRAAIDQIMFFRYKIV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0007264small GTPase mediated signal transduction
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
Vocabulary: Molecular Function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
Vocabulary: INTERPRO
TermDefinition
IPR026791DOCK
IPR026798DOCK6