OSCA025921-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025921-RA
Unique NameOSCA025921-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length58
Homology
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|357623902|gb|EHJ74873.1| (hypothetical protein KGM_06425 [Danaus plexippus])

HSP 1 Score: 99.3673 bits (246), Expect = 6.677e-26
Identity = 43/53 (81.13%), Postives = 50/53 (94.34%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEGE 53
            HPGYV+TDM+SHKGPL+IDEGAAAPLFLALDA DSV+G+YVWY+K+I SW GE
Sbjct:   51 HPGYVNTDMSSHKGPLSIDEGAAAPLFLALDAPDSVRGEYVWYNKKIVSWTGE 103          
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|509163045|gb|JAA79643.1| (Carbonyl reductase [Pararge aegeria])

HSP 1 Score: 98.9821 bits (245), Expect = 1.083e-25
Identity = 42/55 (76.36%), Postives = 50/55 (90.91%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEGETP 55
            HPGYVDTDM+SHKGPL IDEGA APLFLALDA DSV+G+++WY+K+I SW+GE P
Sbjct:   51 HPGYVDTDMSSHKGPLKIDEGAEAPLFLALDAPDSVRGEFIWYNKKIVSWDGEIP 105          
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|909554602|ref|XP_013148778.1| (PREDICTED: carbonyl reductase [NADPH] 1-like [Papilio polytes])

HSP 1 Score: 103.219 bits (256), Expect = 1.505e-25
Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEGE 53
            HPGYVDTDMTSH+G LTIDEGA APLFLALDADDSV+GQYVW DK+I +W+G+
Sbjct:  219 HPGYVDTDMTSHRGHLTIDEGAVAPLFLALDADDSVRGQYVWCDKRIVNWDGQ 271          
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|768420229|ref|XP_011550869.1| (PREDICTED: carbonyl reductase [NADPH] 3-like [Plutella xylostella])

HSP 1 Score: 102.834 bits (255), Expect = 2.251e-25
Identity = 46/58 (79.31%), Postives = 50/58 (86.21%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEGETPSAY 58
            HPGYVDTDMTSHKGPLTIDEGA+APL+LALDA DSVKGQY+W D +I  WEGE P  Y
Sbjct:  219 HPGYVDTDMTSHKGPLTIDEGASAPLYLALDAPDSVKGQYLWRDSKIVDWEGELPGPY 276          
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|930674221|gb|KPJ14620.1| (Carbonyl reductase [NADPH] 1 [Papilio machaon])

HSP 1 Score: 95.1301 bits (235), Expect = 3.542e-24
Identity = 43/56 (76.79%), Postives = 48/56 (85.71%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEGETPS 56
            HPGYVDTDMTSHKG L+IDEGA APLFLALDA DSV+GQYVW DK+I  W+G  P+
Sbjct:   51 HPGYVDTDMTSHKGSLSIDEGAVAPLFLALDAPDSVRGQYVWCDKRIVDWDGPKPN 106          
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|943952438|ref|XP_014359075.1| (PREDICTED: carbonyl reductase [NADPH] 3-like [Papilio machaon])

HSP 1 Score: 99.7525 bits (247), Expect = 3.705e-24
Identity = 43/56 (76.79%), Postives = 48/56 (85.71%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEGETPS 56
            HPGYVDTDMTSHKG L+IDEGA APLFLALDA DSV+GQYVW DK+I  W+G  P+
Sbjct:  219 HPGYVDTDMTSHKGSLSIDEGAVAPLFLALDAPDSVRGQYVWCDKRIVDWDGPKPN 274          
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|943952436|ref|XP_014359074.1| (PREDICTED: carbonyl reductase [NADPH] 1-like [Papilio machaon] >gi|930674220|gb|KPJ14619.1| Carbonyl reductase [NADPH] 1 [Papilio machaon])

HSP 1 Score: 99.3673 bits (246), Expect = 5.535e-24
Identity = 42/55 (76.36%), Postives = 48/55 (87.27%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEGETP 55
            HPGYVDTD+TSHKG L+IDEGA APLFLALDA DSV+GQYVW DK+I  W+G +P
Sbjct:  219 HPGYVDTDLTSHKGTLSIDEGAVAPLFLALDAPDSVRGQYVWCDKRIVDWDGPSP 273          
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|943952440|ref|XP_014359077.1| (PREDICTED: carbonyl reductase [NADPH] 1-like [Papilio machaon] >gi|930674222|gb|KPJ14621.1| Carbonyl reductase [NADPH] 1 [Papilio machaon])

HSP 1 Score: 98.5969 bits (244), Expect = 7.158e-24
Identity = 43/55 (78.18%), Postives = 47/55 (85.45%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEGETP 55
            HPGYVDTDMTSHKG L+IDEGA APLFLALDA DSV+GQYVW DK+I  W+G  P
Sbjct:  219 HPGYVDTDMTSHKGRLSIDEGAVAPLFLALDAPDSVRGQYVWCDKRIVDWDGPKP 273          
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|913322677|ref|XP_013192568.1| (PREDICTED: carbonyl reductase [NADPH] 3-like [Amyelois transitella])

HSP 1 Score: 98.2117 bits (243), Expect = 1.939e-23
Identity = 42/53 (79.25%), Postives = 49/53 (92.45%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEGE 53
            HPGYV+TDM+SHKGPLTIDEGA APL+LALDA DSV+G+YVWY+K+I SW GE
Sbjct:  245 HPGYVNTDMSSHKGPLTIDEGAEAPLYLALDAPDSVQGEYVWYNKKIVSWTGE 297          
BLAST of OSCA025921-RA vs. genbank:protein
Match: gi|910342237|ref|XP_013174851.1| (PREDICTED: carbonyl reductase [NADPH] 1-like [Papilio xuthus] >gi|930652896|gb|KPI95235.1| Carbonyl reductase [NADPH] 1 [Papilio xuthus])

HSP 1 Score: 97.0561 bits (240), Expect = 3.172e-23
Identity = 41/52 (78.85%), Postives = 46/52 (88.46%), Query Frame = 0
Query:    1 HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSWEG 52
            HPGYVDTDMTSHKG LT+DEGA APLFLALDA D+V+GQYVW DK+I  W+G
Sbjct:  219 HPGYVDTDMTSHKGRLTVDEGAVAPLFLALDAPDTVRGQYVWCDKRIVDWDG 270          
The following BLAST results are available for this feature:
BLAST of OSCA025921-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357623902|gb|EHJ74873.1|6.677e-2681.13hypothetical protein KGM_06425 [Danaus plexippus][more]
gi|509163045|gb|JAA79643.1|1.083e-2576.36Carbonyl reductase [Pararge aegeria][more]
gi|909554602|ref|XP_013148778.1|1.505e-2581.13PREDICTED: carbonyl reductase [NADPH] 1-like [Papi... [more]
gi|768420229|ref|XP_011550869.1|2.251e-2579.31PREDICTED: carbonyl reductase [NADPH] 3-like [Plut... [more]
gi|930674221|gb|KPJ14620.1|3.542e-2476.79Carbonyl reductase [NADPH] 1 [Papilio machaon][more]
gi|943952438|ref|XP_014359075.1|3.705e-2476.79PREDICTED: carbonyl reductase [NADPH] 3-like [Papi... [more]
gi|943952436|ref|XP_014359074.1|5.535e-2476.36PREDICTED: carbonyl reductase [NADPH] 1-like [Papi... [more]
gi|943952440|ref|XP_014359077.1|7.158e-2478.18PREDICTED: carbonyl reductase [NADPH] 1-like [Papi... [more]
gi|913322677|ref|XP_013192568.1|1.939e-2379.25PREDICTED: carbonyl reductase [NADPH] 3-like [Amye... [more]
gi|910342237|ref|XP_013174851.1|3.172e-2378.85PREDICTED: carbonyl reductase [NADPH] 1-like [Papi... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0016491 oxidoreductase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016040NAD(P)-binding domainGENE3D3.40.50.720coord: 1..50
e-value: 3.9E-11
score: 41.8
NoneNo IPR availablePANTHERPTHR24322FAMILY NOT NAMEDcoord: 1..57
NoneNo IPR availablePANTHERPTHR24322:SF58CARBONYL REDUCTASE 1-RELATEDcoord: 1..57
NoneNo IPR availableSUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 1..50

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_29536contignewscf_29536:4..180 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025921-RAOSCA025921-RAOstrinia scapulalismRNAnewscf_29536 4..180 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025921-PA ID=OSCA025921-PA|Name=OSCA025921-RA|organism=Ostrinia scapulalis|type=polypeptide|length=58bp
HPGYVDTDMTSHKGPLTIDEGAAAPLFLALDADDSVKGQYVWYDKQITSW
EGETPSAY
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: INTERPRO
TermDefinition
IPR016040NAD(P)-bd_dom