OSCA025922-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025922-RA
Unique NameOSCA025922-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length101
Homology
The following BLAST results are available for this feature:
BLAST of OSCA025922-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0042626 ATPase activity, coupled to transmembrane movement of substances
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 21..42
IPR002699ATPase, V1 complex, subunit DPFAMPF01813ATP-synt_Dcoord: 3..41
e-value: 2.6E-11
score: 43.3
IPR002699ATPase, V1 complex, subunit DPANTHERPTHR11671ATP SYNTHASE SUBUNIT Dcoord: 3..63

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_33739contignewscf_33739:975..1277 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025922-RAOSCA025922-RAOstrinia scapulalismRNAnewscf_33739 975..1277 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025922-PA ID=OSCA025922-PA|Name=OSCA025922-RA|organism=Ostrinia scapulalis|type=polypeptide|length=101bp
KGNVLSKVIAPRLIVTCHYINSELEEKEREETFRLKRVKQKKENMKLHEN
EEYALKKAAASDKGDNISGGEPTKPRKVPDKPADDKESGKDLVVLRAENF
V
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0042626ATPase activity, coupled to transmembrane movement of substances
Vocabulary: INTERPRO
TermDefinition
IPR002699V_ATPase_D