OSCA025948-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025948-RA
Unique NameOSCA025948-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length187
Homology
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|913324145|ref|XP_013193375.1| (PREDICTED: latrophilin Cirl [Amyelois transitella])

HSP 1 Score: 348.206 bits (892), Expect = 3.279e-108
Identity = 172/189 (91.01%), Postives = 179/189 (94.71%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQ-HHGSSGSKFFGDHRPLISYSPGERHHHE-EHYGKYGKWDTLERYDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYKE+GRRKHHHHHGSQN+NHTYSEIGSQ GR+YRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQ    HGSSGSKFFGDHRPLISYSPGERH HE E YGKYGKWDT ERYDPRHY+SGRL+HPYHQPQE+NMRALAAVLNGENNVVCHLEPHN+YDVYQ QSGNPRTVSQPSF
Sbjct: 1332 FRKHYKEEGRRKHHHHHGSQNINHTYSEIGSQQGRIYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQNPGLHGSSGSKFFGDHRPLISYSPGERHLHEQELYGKYGKWDTAERYDPRHYDSGRLVHPYHQPQESNMRALAAVLNGENNVVCHLEPHNAYDVYQSQSGNPRTVSQPSF 1520          
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|357604185|gb|EHJ64079.1| (latrophilin-like receptor [Danaus plexippus])

HSP 1 Score: 317.005 bits (811), Expect = 6.583e-107
Identity = 167/191 (87.43%), Postives = 174/191 (91.10%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQ-HHGSSGSKFFGDHRPLISYSPGERHHHE-EHYGKYGKWDTLER-YDPRH-YESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYK++ RRKHHHH GSQNVNHTYSEI SQ GR+YRRGSE EFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQ   HHGS+ SKFFGDHRPLISYSPGERHHHE EHYGKYGKWD +ER YDPRH YESGRLMH  +QPQEN MRALAAVLNGENNVVCHLEPHNSYDVYQPQ+GN RTVSQPSF
Sbjct:  112 FRKHYKDENRRKHHHH-GSQNVNHTYSEIASQQGRIYRRGSE-EFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQNPGHHGSTSSKFFGDHRPLISYSPGERHHHETEHYGKYGKWDAMERPYDPRHAYESGRLMH--YQPQEN-MRALAAVLNGENNVVCHLEPHNSYDVYQPQTGNQRTVSQPSF 297          
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|914573128|gb|KOB75762.1| (Latrophilin-like receptor [Operophtera brumata])

HSP 1 Score: 340.502 bits (872), Expect = 3.044e-106
Identity = 165/187 (88.24%), Postives = 172/187 (91.98%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQHHGSSGSKFFGDHRPLISYSPGERHHHEEHYGKYGKWDTLERYDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYK D RRKHHHHHGSQN+NHTYSEI  Q GR+YRRGSE EFRVIQDDPVYEEIERNETLMSD+SDDNSGPDN +   HHGSS SKFFGDHRPLISYSPGER H EEHYGKYGKWD +ERYDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSY+ YQPQ+GNPRTVSQPSF
Sbjct: 1112 FRKHYK-DERRKHHHHHGSQNINHTYSEIAGQQGRIYRRGSE-EFRVIQDDPVYEEIERNETLMSDVSDDNSGPDNRQPPGHHGSSSSKFFGDHRPLISYSPGERIHQEEHYGKYGKWDNMERYDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYEGYQPQTGNPRTVSQPSF 1296          
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|768447862|ref|XP_011565932.1| (PREDICTED: uncharacterized protein LOC105395672, partial [Plutella xylostella])

HSP 1 Score: 320.472 bits (820), Expect = 5.347e-106
Identity = 170/196 (86.73%), Postives = 178/196 (90.82%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQP--GRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQ-HHGSSGSKFFGDHRPLISYSPGERHHHEEHYGKYG--KWDTLER-YDPRH--YESGRLM-HPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYKE+ RRKHHHH GSQN+NHTYSEI +Q   GR+YRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPD+CRQ   HHGSS SKF+GDHRPLISYSPGERHHHEEH+ KYG  KWD+LER YDPRH  YESGRLM HPYHQPQE NMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF
Sbjct:  263 FRKHYKEESRRKHHHH-GSQNINHTYSEIAAQQQQGRLYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDSCRQNPGHHGSSSSKFYGDHRPLISYSPGERHHHEEHF-KYGGNKWDSLERSYDPRHAAYESGRLMGHPYHQPQE-NMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 455          
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|909554783|ref|XP_013148873.1| (PREDICTED: latrophilin Cirl isoform X1 [Papilio polytes] >gi|909554785|ref|XP_013148874.1| PREDICTED: latrophilin Cirl isoform X1 [Papilio polytes] >gi|909554787|ref|XP_013148876.1| PREDICTED: latrophilin Cirl isoform X1 [Papilio polytes])

HSP 1 Score: 341.273 bits (874), Expect = 5.610e-106
Identity = 169/190 (88.95%), Postives = 174/190 (91.58%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQ-HHGSSGSKFFGDHRPLISYSPGERHHHE-EHYGKYGKWDTLER-YDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYK+D R+   HHHGSQ VNHTYSEI SQ GRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQ   HHGSS SKFFGDHRPLISYSPG+RHHHE EHYGKYGKWDTL+R YD   YESGRL+HPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF
Sbjct: 1254 FRKHYKDDRRK---HHHGSQGVNHTYSEIASQQGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQNPGHHGSSSSKFFGDHRPLISYSPGDRHHHEQEHYGKYGKWDTLDRGYDRHAYESGRLVHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 1440          
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|910342063|ref|XP_013174760.1| (PREDICTED: latrophilin Cirl isoform X2 [Papilio xuthus])

HSP 1 Score: 340.887 bits (873), Expect = 9.592e-106
Identity = 169/190 (88.95%), Postives = 174/190 (91.58%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQ-HHGSSGSKFFGDHRPLISYSPGERHHHE-EHYGKYGKWDTLER-YDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYK+D R+   HHHGSQ+VNHTYSEI SQ GRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQ   HHGSS SKFFGDHRPLISYSPG+RHHHE EHYGKYGKWDTL+R YD   YESGRL HPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF
Sbjct: 1268 FRKHYKDDRRK---HHHGSQSVNHTYSEIASQQGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQNPGHHGSSSSKFFGDHRPLISYSPGDRHHHEQEHYGKYGKWDTLDRAYDRHAYESGRLAHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 1454          
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|910342059|ref|XP_013174758.1| (PREDICTED: latrophilin Cirl isoform X1 [Papilio xuthus] >gi|910342061|ref|XP_013174759.1| PREDICTED: latrophilin Cirl isoform X1 [Papilio xuthus])

HSP 1 Score: 341.273 bits (874), Expect = 1.093e-105
Identity = 169/190 (88.95%), Postives = 174/190 (91.58%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQ-HHGSSGSKFFGDHRPLISYSPGERHHHE-EHYGKYGKWDTLER-YDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYK+D R+   HHHGSQ+VNHTYSEI SQ GRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQ   HHGSS SKFFGDHRPLISYSPG+RHHHE EHYGKYGKWDTL+R YD   YESGRL HPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF
Sbjct: 1367 FRKHYKDDRRK---HHHGSQSVNHTYSEIASQQGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQNPGHHGSSSSKFFGDHRPLISYSPGDRHHHEQEHYGKYGKWDTLDRAYDRHAYESGRLAHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 1553          
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|930664501|gb|KPJ05809.1| (Latrophilin Cirl [Papilio xuthus])

HSP 1 Score: 340.887 bits (873), Expect = 1.343e-105
Identity = 169/190 (88.95%), Postives = 174/190 (91.58%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQ-HHGSSGSKFFGDHRPLISYSPGERHHHE-EHYGKYGKWDTLER-YDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYK+D R+   HHHGSQ+VNHTYSEI SQ GRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQ   HHGSS SKFFGDHRPLISYSPG+RHHHE EHYGKYGKWDTL+R YD   YESGRL HPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF
Sbjct: 1327 FRKHYKDDRRK---HHHGSQSVNHTYSEIASQQGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQNPGHHGSSSSKFFGDHRPLISYSPGDRHHHEQEHYGKYGKWDTLDRAYDRHAYESGRLAHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 1513          
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|943937429|ref|XP_014370112.1| (PREDICTED: latrophilin Cirl [Papilio machaon])

HSP 1 Score: 336.265 bits (861), Expect = 8.138e-104
Identity = 167/190 (87.89%), Postives = 173/190 (91.05%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQ-HHGSSGSKFFGDHRPLISYSPGERHHHE-EHYGKYGKWDTLER-YDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYK+D R+   HHHGSQ+VNHTYSEI SQ GRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQ   HHGSS SKFFGDHRPLISYSPG+RHHHE EHYGKYGKWDTL+R YD   YESGR+ H YHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF
Sbjct: 1370 FRKHYKDDRRK---HHHGSQSVNHTYSEIASQQGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQNPGHHGSSSSKFFGDHRPLISYSPGDRHHHEQEHYGKYGKWDTLDRAYDRHAYESGRMAHTYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 1556          
BLAST of OSCA025948-RA vs. genbank:protein
Match: gi|930679416|gb|KPJ19282.1| (Latrophilin Cirl [Papilio machaon])

HSP 1 Score: 336.265 bits (861), Expect = 1.247e-103
Identity = 167/190 (87.89%), Postives = 173/190 (91.05%), Query Frame = 0
Query:    1 FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQTQ-HHGSSGSKFFGDHRPLISYSPGERHHHE-EHYGKYGKWDTLER-YDPRHYESGRLMHPYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 187
            FRKHYK+D R+   HHHGSQ+VNHTYSEI SQ GRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQ   HHGSS SKFFGDHRPLISYSPG+RHHHE EHYGKYGKWDTL+R YD   YESGR+ H YHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF
Sbjct: 1470 FRKHYKDDRRK---HHHGSQSVNHTYSEIASQQGRMYRRGSEQEFRVIQDDPVYEEIERNETLMSDMSDDNSGPDNCRQNPGHHGSSSSKFFGDHRPLISYSPGDRHHHEQEHYGKYGKWDTLDRAYDRHAYESGRMAHTYHQPQENNMRALAAVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF 1656          
The following BLAST results are available for this feature:
BLAST of OSCA025948-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913324145|ref|XP_013193375.1|3.279e-10891.01PREDICTED: latrophilin Cirl [Amyelois transitella][more]
gi|357604185|gb|EHJ64079.1|6.583e-10787.43latrophilin-like receptor [Danaus plexippus][more]
gi|914573128|gb|KOB75762.1|3.044e-10688.24Latrophilin-like receptor [Operophtera brumata][more]
gi|768447862|ref|XP_011565932.1|5.347e-10686.73PREDICTED: uncharacterized protein LOC105395672, p... [more]
gi|909554783|ref|XP_013148873.1|5.610e-10688.95PREDICTED: latrophilin Cirl isoform X1 [Papilio po... [more]
gi|910342063|ref|XP_013174760.1|9.592e-10688.95PREDICTED: latrophilin Cirl isoform X2 [Papilio xu... [more]
gi|910342059|ref|XP_013174758.1|1.093e-10588.95PREDICTED: latrophilin Cirl isoform X1 [Papilio xu... [more]
gi|930664501|gb|KPJ05809.1|1.343e-10588.95Latrophilin Cirl [Papilio xuthus][more]
gi|943937429|ref|XP_014370112.1|8.138e-10487.89PREDICTED: latrophilin Cirl [Papilio machaon][more]
gi|930679416|gb|KPJ19282.1|1.247e-10387.89Latrophilin Cirl [Papilio machaon][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007166 cell surface receptor signaling pathway
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0030246 carbohydrate binding
molecular_function GO:0004930 G-protein coupled receptor activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_17362contignewscf_17362:3..566 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025948-RAOSCA025948-RAOstrinia scapulalismRNAnewscf_17362 3..566 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025948-PA ID=OSCA025948-PA|Name=OSCA025948-RA|organism=Ostrinia scapulalis|type=polypeptide|length=187bp
FRKHYKEDGRRKHHHHHGSQNVNHTYSEIGSQPGRMYRRGSEQEFRVIQD
DPVYEEIERNETLMSDMSDDNSGPDNCRQTQHHGSSGSKFFGDHRPLISY
SPGERHHHEEHYGKYGKWDTLERYDPRHYESGRLMHPYHQPQENNMRALA
AVLNGENNVVCHLEPHNSYDVYQPQSGNPRTVSQPSF
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0030246carbohydrate binding
GO:0004930G-protein coupled receptor activity