OSCA025949-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025949-RA
Unique NameOSCA025949-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length88
Homology
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 101.679 bits (252), Expect = 7.545e-24
Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDL 51
            I RRIAKIK QWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPP+RWTDDL
Sbjct:  280 IARRIAKIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDL 330          
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 102.449 bits (254), Expect = 1.151e-23
Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDL 51
            I RRIAKIK QWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPP+RWTDDL
Sbjct:  414 IARRIAKIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDL 464          
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 102.064 bits (253), Expect = 1.491e-23
Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDL 51
            I RRIAKIK QWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPP+RWTDDL
Sbjct:  395 IARRIAKIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDL 445          
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 101.679 bits (252), Expect = 3.447e-23
Identity = 42/51 (82.35%), Postives = 48/51 (94.12%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDL 51
            I RRI+K+K QWAGHIARR+DGRWGRK+LEWRPR G+RSVGRPP+RWTDDL
Sbjct:  910 IARRISKLKWQWAGHIARRSDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 960          
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|827536156|ref|XP_012544942.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101741607, partial [Bombyx mori])

HSP 1 Score: 93.2041 bits (230), Expect = 3.199e-21
Identity = 41/51 (80.39%), Postives = 47/51 (92.16%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDL 51
            I RRI+++K QWAGHIARR DGRWGRK+LEWRPR G+RSVGRPP+RWTDDL
Sbjct:  187 IARRISELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 237          
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|357603461|gb|EHJ63790.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 90.5077 bits (223), Expect = 7.575e-21
Identity = 42/55 (76.36%), Postives = 47/55 (85.45%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDLGGAG 55
            I +RI+ +K QWAGHIARR DGRWGRKVLEWRPR G+RSVGRPP+RWTDDL  A 
Sbjct:  110 IAKRISSLKWQWAGHIARRTDGRWGRKVLEWRPRIGKRSVGRPPTRWTDDLVKAA 164          
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 94.7449 bits (234), Expect = 9.422e-21
Identity = 41/51 (80.39%), Postives = 47/51 (92.16%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDL 51
            I RRI+++K QWAGHIARR DGRWGRK+LEWRPR G+RSVGRPP+RWTDDL
Sbjct:  910 IARRISELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 960          
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|827560966|ref|XP_012551328.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101744003 [Bombyx mori])

HSP 1 Score: 92.8189 bits (229), Expect = 3.471e-20
Identity = 40/51 (78.43%), Postives = 47/51 (92.16%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDL 51
            I RR++++K QWAGHIARR DGRWGRK+LEWRPR G+RSVGRPP+RWTDDL
Sbjct:  423 IARRLSELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 473          
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 85.8853 bits (211), Expect = 2.423e-19
Identity = 37/51 (72.55%), Postives = 45/51 (88.24%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDL 51
            +  R++K+K QWAGHIARR DGRW R+VLEWRPR G+RSVGRPP+RWTDD+
Sbjct:   77 MAYRVSKLKWQWAGHIARRTDGRWSRRVLEWRPRTGKRSVGRPPARWTDDI 127          
BLAST of OSCA025949-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 90.1225 bits (222), Expect = 3.378e-19
Identity = 41/51 (80.39%), Postives = 45/51 (88.24%), Query Frame = 0
Query:    1 IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDDL 51
            I RRI  +K +WAGHIARR DGRWGR+VLEWRPR GRRSVGRPP+RWTDDL
Sbjct:  687 IARRIVNLKWRWAGHIARRTDGRWGRRVLEWRPRIGRRSVGRPPARWTDDL 737          
The following BLAST results are available for this feature:
BLAST of OSCA025949-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001247|gb|ABO45233.1|7.545e-2494.12reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|1.151e-2394.12reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|1.491e-2394.12reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|298204327|gb|ADI61812.1|3.447e-2382.35endonuclease-reverse transcriptase [Bombyx mori][more]
gi|827536156|ref|XP_012544942.1|3.199e-2180.39PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|357603461|gb|EHJ63790.1|7.575e-2176.36endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204325|gb|ADI61811.1|9.422e-2180.39endonuclease-reverse transcriptase [Bombyx mori][more]
gi|827560966|ref|XP_012551328.1|3.471e-2078.43PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|825740785|ref|WP_047149388.1|2.423e-1972.55hypothetical protein, partial [Escherichia coli][more]
gi|909577882|ref|XP_013144778.1|3.378e-1980.39PREDICTED: uncharacterized protein LOC106108224 [P... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_44840contignewscf_44840:4..270 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025949-RAOSCA025949-RAOstrinia scapulalismRNAnewscf_44840 4..270 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025949-PA ID=OSCA025949-PA|Name=OSCA025949-RA|organism=Ostrinia scapulalis|type=polypeptide|length=88bp
IVRRIAKIKRQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPSRWTDD
LGGAGLVYVEILLGGLCPAVDVFRLKRTNSGSVLKRAS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity