OSCA025950-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025950-RA
Unique NameOSCA025950-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length104
Homology
BLAST of OSCA025950-RA vs. genbank:protein
Match: gi|512935605|ref|XP_004933314.1| (PREDICTED: uncharacterized protein LOC101739238 [Bombyx mori])

HSP 1 Score: 64.6994 bits (156), Expect = 2.044e-11
Identity = 37/61 (60.66%), Postives = 40/61 (65.57%), Query Frame = 0
Query:    9 KASPKFFHNERSCPARIQALPTAFTRSSVHLIGGLPMLRLPARG-HSRTFLPQRPSSLRAI 68
            K S   F  +RS    IQ  P  F RSSVHL+GG P LRLP RG HSR FLP RPSSLRA+
Sbjct:   43 KISLADFQCDRSIATCIQRDPALFIRSSVHLVGGRPTLRLPVRGRHSRIFLPHRPSSLRAM 103          
BLAST of OSCA025950-RA vs. genbank:protein
Match: gi|930665739|gb|KPJ06866.1| (hypothetical protein RR48_11365 [Papilio machaon])

HSP 1 Score: 63.929 bits (154), Expect = 8.343e-10
Identity = 35/61 (57.38%), Postives = 39/61 (63.93%), Query Frame = 0
Query:   10 ASPKFFHNERSCPARIQALPTAFTRSSVHLIGGLPMLRLPARG-HSRTFLPQRPSSLRAII 69
            ASPK  H++ SC  RIQ  P   TRSSVHL GGL  LR P RG HS T  P RPS LR ++
Sbjct:  190 ASPKDRHDDGSCATRIQDTPATLTRSSVHLAGGLRTLRQPVRGRHSSTLRPHRPSILRLLV 250          
The following BLAST results are available for this feature:
BLAST of OSCA025950-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 2
Match NameE-valueIdentityDescription
gi|512935605|ref|XP_004933314.1|2.044e-1160.66PREDICTED: uncharacterized protein LOC101739238 [B... [more]
gi|930665739|gb|KPJ06866.1|8.343e-1057.38hypothetical protein RR48_11365 [Papilio machaon][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_17560contignewscf_17560:463..777 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025950-RAOSCA025950-RAOstrinia scapulalismRNAnewscf_17560 463..777 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025950-PA ID=OSCA025950-PA|Name=OSCA025950-RA|organism=Ostrinia scapulalis|type=polypeptide|length=104bp
PNDVHCWTKASPKFFHNERSCPARIQALPTAFTRSSVHLIGGLPMLRLPA
RGHSRTFLPQRPSSLRAIIELPETLRFHHHHHFSHKTSTAEHRPPPMLSM
LPGW
back to top