OSCA025951-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025951-RA
Unique NameOSCA025951-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length91
Homology
BLAST of OSCA025951-RA vs. genbank:protein
Match: gi|838097683|gb|KLV34197.1| (hypothetical protein AB894_15350, partial [Piscirickettsia salmonis])

HSP 1 Score: 101.679 bits (252), Expect = 3.794e-23
Identity = 48/82 (58.54%), Postives = 59/82 (71.95%), Query Frame = 0
Query:    9 SDEKAKLIPPAPFHDRGTRRRLVYHPYIVDIPPARTKRFDDSFIMRTAMDWNSLPAAVFPEDNNPGIFKARVNRHLQGRYVP 90
            + E   LIPP+PFH R TR+    H ++VDIPP RTKRF  SF++RTA +WNSLP +VFP+  N G+FKARVNR L GR  P
Sbjct:  639 AGELHNLIPPSPFHHRTTRQSARRHRFMVDIPPTRTKRFASSFLVRTAREWNSLPESVFPDGYNLGVFKARVNRLLMGRRAP 720          
BLAST of OSCA025951-RA vs. genbank:protein
Match: gi|930681747|gb|KPJ21287.1| (hypothetical protein RR48_00627 [Papilio machaon])

HSP 1 Score: 67.781 bits (164), Expect = 2.716e-13
Identity = 32/54 (59.26%), Postives = 39/54 (72.22%), Query Frame = 0
Query:   33 HPYIVDIPPARTKRFDDSFIMRTAMDWNSLPAAVFPEDNNPGIFKARVNRHLQG 86
            HPY+VDI   RTKRF+ SF++RTA DWN   A+VFP   + G  K+RVNRHLQ 
Sbjct:    9 HPYVVDI---RTKRFESSFLVRTAKDWNMSAASVFPSKYDVGASKSRVNRHLQS 59          
BLAST of OSCA025951-RA vs. genbank:protein
Match: gi|357624391|gb|EHJ75178.1| (reverse transcriptase [Danaus plexippus])

HSP 1 Score: 67.781 bits (164), Expect = 1.095e-12
Identity = 30/69 (43.48%), Postives = 45/69 (65.22%), Query Frame = 0
Query:   11 EKAKLIPPAPFHDRGTRRRLVYHPYIVDIPPARTKRFDDSFIMRTAMDWNSLPAAVFPEDNNPGIFKAR 79
            E   LIP +PF++R T+  +  +P++++ P  RTKR+  SF+MRTA DWNSL  + F    N G+FK +
Sbjct:   51 ELHNLIPASPFYNRTTKCTVGLYPFVLNFPRIRTKRYVSSFLMRTARDWNSLLVSEFLSSYNLGVFKKK 119          
BLAST of OSCA025951-RA vs. genbank:protein
Match: gi|512899552|ref|XP_004924674.1| (PREDICTED: uncharacterized protein LOC101745997 [Bombyx mori])

HSP 1 Score: 67.3958 bits (163), Expect = 9.046e-12
Identity = 36/79 (45.57%), Postives = 50/79 (63.29%), Query Frame = 0
Query:    9 SDEKAKLIPPAPFHDRGTRRRLVYHPYIVDIPPARTKRFDDSFIMRTAMDWNSLPAAVFPEDNNPGIFKARVNRHLQGR 87
            S+E   LI  A F +R +RR   YHP+ +D   + T RF +SF+ RT   WNSLP+AVFP + + G+FK R   +L+GR
Sbjct:  118 SEELFNLIEAADFSNRSSRRN--YHPHHLDGWRSTTMRFKNSFLPRTVNLWNSLPSAVFPNNCDIGLFKKRAYSYLKGR 194          
BLAST of OSCA025951-RA vs. genbank:protein
Match: gi|910347296|ref|XP_013177579.1| (PREDICTED: uncharacterized protein LOC106125039 [Papilio xuthus])

HSP 1 Score: 64.3142 bits (155), Expect = 1.115e-10
Identity = 35/83 (42.17%), Postives = 46/83 (55.42%), Query Frame = 0
Query:    5 HLVKSDEKAKLIPPAPFHDRGTRRRLVYHPYIVDIPPARTKRFDDSFIMRTAMDWNSLPAAVFPEDNNPGIFKARVNRHLQGR 87
            H   S+E    IP A F  R TR+   +HP+ +D   + T RF  +F+ RTA  WN L +AVFP   + G FK R   HL+GR
Sbjct:   92 HGECSEELFGTIPAAEFRHRTTRQAARFHPHHLDGWHSTTVRFSRNFLPRTATLWNGLSSAVFPNQYDLGSFKKRAYHHLKGR 174          
BLAST of OSCA025951-RA vs. genbank:protein
Match: gi|910319275|ref|XP_013162491.1| (PREDICTED: uncharacterized protein LOC106113978 [Papilio xuthus])

HSP 1 Score: 62.3882 bits (150), Expect = 1.251e-9
Identity = 35/83 (42.17%), Postives = 45/83 (54.22%), Query Frame = 0
Query:    5 HLVKSDEKAKLIPPAPFHDRGTRRRLVYHPYIVDIPPARTKRFDDSFIMRTAMDWNSLPAAVFPEDNNPGIFKARVNRHLQGR 87
            H   S+E    IP A F  R TR+   +HP+  D   + T RF  +F+ RTA  WN L +AVFP   + G FK R   HL+GR
Sbjct:  146 HGECSEELFGTIPAAEFRHRTTRQTARFHPHHFDGWQSTTVRFARNFLPRTAALWNGLSSAVFPNRYDLGSFKKRAYHHLKGR 228          
BLAST of OSCA025951-RA vs. genbank:protein
Match: gi|433339045|dbj|BAM73877.1| (cytochrome P450, partial [Bombyx mori])

HSP 1 Score: 58.9214 bits (141), Expect = 2.159e-9
Identity = 33/83 (39.76%), Postives = 45/83 (54.22%), Query Frame = 0
Query:    5 HLVKSDEKAKLIPPAPFHDRGTRRRLVYHPYIVDIPPARTKRFDDSFIMRTAMDWNSLPAAVFPEDNNPGIFKARVNRHLQGR 87
            H   S+E  ++IP + F+ R  R R   HPY ++   + T RF  SF+ RT   WN LP+ VFPE  +   FK  + R L GR
Sbjct:    5 HGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSGR 87          
BLAST of OSCA025951-RA vs. genbank:protein
Match: gi|910317225|ref|XP_013161376.1| (PREDICTED: uncharacterized protein LOC106113188, partial [Papilio xuthus])

HSP 1 Score: 60.8474 bits (146), Expect = 3.886e-9
Identity = 34/83 (40.96%), Postives = 45/83 (54.22%), Query Frame = 0
Query:    5 HLVKSDEKAKLIPPAPFHDRGTRRRLVYHPYIVDIPPARTKRFDDSFIMRTAMDWNSLPAAVFPEDNNPGIFKARVNRHLQGR 87
            H   S+E    IP A F  R TR+   +HP+ +D   +   RF  +F+ RTA  WN L +AVFP   + G FK R   HL+GR
Sbjct:  156 HGECSEELFGTIPAAEFRHRTTRQTARFHPHHLDGWHSTRVRFSRNFLPRTAALWNGLSSAVFPNQYDLGSFKKRAYHHLKGR 238          
The following BLAST results are available for this feature:
BLAST of OSCA025951-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 8
Match NameE-valueIdentityDescription
gi|838097683|gb|KLV34197.1|3.794e-2358.54hypothetical protein AB894_15350, partial [Pisciri... [more]
gi|930681747|gb|KPJ21287.1|2.716e-1359.26hypothetical protein RR48_00627 [Papilio machaon][more]
gi|357624391|gb|EHJ75178.1|1.095e-1243.48reverse transcriptase [Danaus plexippus][more]
gi|512899552|ref|XP_004924674.1|9.046e-1245.57PREDICTED: uncharacterized protein LOC101745997 [B... [more]
gi|910347296|ref|XP_013177579.1|1.115e-1042.17PREDICTED: uncharacterized protein LOC106125039 [P... [more]
gi|910319275|ref|XP_013162491.1|1.251e-942.17PREDICTED: uncharacterized protein LOC106113978 [P... [more]
gi|433339045|dbj|BAM73877.1|2.159e-939.76cytochrome P450, partial [Bombyx mori][more]
gi|910317225|ref|XP_013161376.1|3.886e-940.96PREDICTED: uncharacterized protein LOC106113188, p... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_45852contignewscf_45852:335..610 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025951-RAOSCA025951-RAOstrinia scapulalismRNAnewscf_45852 335..610 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025951-PA ID=OSCA025951-PA|Name=OSCA025951-RA|organism=Ostrinia scapulalis|type=polypeptide|length=91bp
MLASHLVKSDEKAKLIPPAPFHDRGTRRRLVYHPYIVDIPPARTKRFDDS
FIMRTAMDWNSLPAAVFPEDNNPGIFKARVNRHLQGRYVPF
back to top