OSCA025952-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025952-RA
Unique NameOSCA025952-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length71
Homology
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 88.1965 bits (217), Expect = 8.440e-19
Identity = 37/53 (69.81%), Postives = 41/53 (77.36%), Query Frame = 0
Query:    2 DGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMHATV-RCGWKSLG 53
            DGRWG K+LEWRPRTGK SVGRPPTRWTDDL+   G RWM   + R  WKS+G
Sbjct:  930 DGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKSAGSRWMQVAMDRSHWKSIG 982          
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 86.6557 bits (213), Expect = 3.052e-18
Identity = 37/53 (69.81%), Postives = 41/53 (77.36%), Query Frame = 0
Query:    2 DGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMH-ATVRCGWKSLG 53
            DGRWG K+LEWRPRTGK SVGRPPTRWTDDL+ + G  WM  AT R  W S+G
Sbjct:  930 DGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKISGSHWMQVATDRPHWTSVG 982          
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|357610206|gb|EHJ66868.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 83.9593 bits (206), Expect = 2.411e-17
Identity = 35/51 (68.63%), Postives = 39/51 (76.47%), Query Frame = 0
Query:    2 DGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMH-ATVRCGWKS 51
            DGRW  KVLEW+PR GK S+GRPPTRWTDDL+   G RWMH A+ R  WKS
Sbjct:  488 DGRWSRKVLEWKPRIGKRSIGRPPTRWTDDLVKAAGSRWMHVASDRTAWKS 538          
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 83.1889 bits (204), Expect = 4.664e-17
Identity = 36/53 (67.92%), Postives = 39/53 (73.58%), Query Frame = 0
Query:    2 DGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMHATV-RCGWKSLG 53
            DGRWG KVLEWRPRTG+ SVGRPPTRW DDL+   G RWM A   R  W+ LG
Sbjct:  926 DGRWGQKVLEWRPRTGRRSVGRPPTRWADDLLRFAGIRWMQAAQDRSLWRGLG 978          
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|930658195|gb|KPJ00401.1| (hypothetical protein RR46_06991 [Papilio xuthus])

HSP 1 Score: 76.2554 bits (186), Expect = 6.942e-17
Identity = 40/71 (56.34%), Postives = 45/71 (63.38%), Query Frame = 0
Query:    1 MDGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMHATVRCGWKSLGLWEPLGGLCPAVDVLWLK 71
            MDGRWG   LEWRPRTG+ SV RPP RWTDDL+ V G  WM        ++   W   GGLCPAV  LWL+
Sbjct:    1 MDGRWGRNFLEWRPRTGRRSVVRPPARWTDDLVRVAGASWMQVA-----QNRSSWLSGGGLCPAVGDLWLR 66          
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 75.485 bits (184), Expect = 1.188e-16
Identity = 38/54 (70.37%), Postives = 41/54 (75.93%), Query Frame = 0
Query:    1 MDGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMH-ATVRCGWKSLG 53
            MDGRWG KVLEWRPRTG+ SVGRPP RWTDDL+ V G  WM  A  R  W+SLG
Sbjct:    1 MDGRWGRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLG 54          
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|930648975|gb|KPI91323.1| (hypothetical protein RR46_14827 [Papilio xuthus])

HSP 1 Score: 75.0998 bits (183), Expect = 3.156e-16
Identity = 37/53 (69.81%), Postives = 40/53 (75.47%), Query Frame = 0
Query:    2 DGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMH-ATVRCGWKSLG 53
            DGRWG KVLEWRPRTG+ SVGRPP RWTDDL+ V G  WM  A  R  W+SLG
Sbjct:   19 DGRWGRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLG 71          
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|298204329|gb|ADI61813.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 80.8777 bits (198), Expect = 3.337e-16
Identity = 35/53 (66.04%), Postives = 38/53 (71.70%), Query Frame = 0
Query:    2 DGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMH-ATVRCGWKSLG 53
            D RWG KV+EWRPR G  SVGRPPTRWTDDL+   G RWM  A  R  WK+LG
Sbjct:  924 DARWGRKVIEWRPRMGTRSVGRPPTRWTDDLVRTAGSRWMRKAEDRIMWKALG 976          
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|838097688|gb|KLV34200.1| (hypothetical protein AB894_15325, partial [Piscirickettsia salmonis])

HSP 1 Score: 80.1073 bits (196), Expect = 6.139e-16
Identity = 33/53 (62.26%), Postives = 39/53 (73.58%), Query Frame = 0
Query:    2 DGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMH-ATVRCGWKSLG 53
            DGRW  KV EWRPRTG+ SVGRPPTRWTDD++ V G +WM  A  R  W++ G
Sbjct:  759 DGRWARKVTEWRPRTGRRSVGRPPTRWTDDIVRVAGSQWMQVAACRSTWRTKG 811          
BLAST of OSCA025952-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 79.7221 bits (195), Expect = 8.054e-16
Identity = 34/53 (64.15%), Postives = 39/53 (73.58%), Query Frame = 0
Query:    2 DGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMHATV-RCGWKSLG 53
            DGRWG +VLEWRPR G+ SVGRPP RWTDDL+ V G  WM A   R  W+S+G
Sbjct:  707 DGRWGRRVLEWRPRIGRRSVGRPPARWTDDLVKVAGAHWMRAAQDRALWQSMG 759          
The following BLAST results are available for this feature:
BLAST of OSCA025952-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|298204325|gb|ADI61811.1|8.440e-1969.81endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204327|gb|ADI61812.1|3.052e-1869.81endonuclease-reverse transcriptase [Bombyx mori][more]
gi|357610206|gb|EHJ66868.1|2.411e-1768.63endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204337|gb|ADI61817.1|4.664e-1767.92endonuclease-reverse transcriptase [Bombyx mori][more]
gi|930658195|gb|KPJ00401.1|6.942e-1756.34hypothetical protein RR46_06991 [Papilio xuthus][more]
gi|930681186|gb|KPJ20726.1|1.188e-1670.37hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|930648975|gb|KPI91323.1|3.156e-1669.81hypothetical protein RR46_14827 [Papilio xuthus][more]
gi|298204329|gb|ADI61813.1|3.337e-1666.04endonuclease-reverse transcriptase [Bombyx mori][more]
gi|838097688|gb|KLV34200.1|6.139e-1662.26hypothetical protein AB894_15325, partial [Pisciri... [more]
gi|909577882|ref|XP_013144778.1|8.054e-1664.15PREDICTED: uncharacterized protein LOC106108224 [P... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090304 nucleic acid metabolic process
molecular_function GO:0003824 catalytic activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_41519contignewscf_41519:95..310 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025952-RAOSCA025952-RAOstrinia scapulalismRNAnewscf_41519 95..310 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025952-PA ID=OSCA025952-PA|Name=OSCA025952-RA|organism=Ostrinia scapulalis|type=polypeptide|length=71bp
MDGRWGSKVLEWRPRTGKCSVGRPPTRWTDDLINVVGRRWMHATVRCGWK
SLGLWEPLGGLCPAVDVLWLK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0090304nucleic acid metabolic process