OSCA025953-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025953-RA
Unique NameOSCA025953-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length63
Homology
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|930659181|gb|KPJ01280.1| (hypothetical protein RR46_01415 [Papilio xuthus])

HSP 1 Score: 68.9366 bits (167), Expect = 1.668e-12
Identity = 28/48 (58.33%), Postives = 36/48 (75.00%), Query Frame = 0
Query:    5 GYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTSY 52
            G   +G    RWTDDL+KVAG  WM+A  +R LW+S+G+AYVQQWTS+
Sbjct:   47 GRRSVGKPPARWTDDLVKVAGVHWMRAAQDRALWQSMGEAYVQQWTSH 94          
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 69.707 bits (169), Expect = 1.702e-12
Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 0
Query:    5 GYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTSY 52
            G   +G   TRWTDDL+KVAG  WMQA  +R LWKSLG+A+VQQWTS+
Sbjct:  315 GRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 362          
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 69.707 bits (169), Expect = 1.834e-12
Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 0
Query:    5 GYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTSY 52
            G   +G   TRWTDDL+KVAG  WMQA  +R LWKSLG+A+VQQWTS+
Sbjct:  430 GRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 477          
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 69.707 bits (169), Expect = 1.952e-12
Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 0
Query:    5 GYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTSY 52
            G   +G   TRWTDDL+KVAG  WMQA  +R LWKSLG+A+VQQWTS+
Sbjct:  449 GRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 496          
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 67.3958 bits (163), Expect = 1.168e-11
Identity = 28/49 (57.14%), Postives = 37/49 (75.51%), Query Frame = 0
Query:    4 VGYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTSY 52
            +G   +G    RWTDDL+KVAG  WM+A  +R LW+S+G+AYVQQWT+Y
Sbjct:  721 IGRRSVGRPPARWTDDLVKVAGAHWMRAAQDRALWQSMGEAYVQQWTTY 769          
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 64.6994 bits (156), Expect = 1.709e-11
Identity = 28/48 (58.33%), Postives = 36/48 (75.00%), Query Frame = 0
Query:    5 GYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTSY 52
            G   +G    RWTDD++K AG+ WM+A ++R  WKSLG+AYVQQWTSY
Sbjct:  112 GKRSVGRPPARWTDDIVKSAGKHWMRAASDRTRWKSLGEAYVQQWTSY 159          
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|930664358|gb|KPJ05678.1| (hypothetical protein RR46_00407 [Papilio xuthus])

HSP 1 Score: 63.1586 bits (152), Expect = 1.993e-11
Identity = 29/48 (60.42%), Postives = 36/48 (75.00%), Query Frame = 0
Query:    4 VGYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTS 51
            VG     G   RWTDDL+KVAG RWM+A  + PLW+S+G+AYVQQWT+
Sbjct:   68 VGRPPSVGRKARWTDDLVKVAGVRWMRAAPDLPLWQSMGEAYVQQWTN 115          
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 65.4698 bits (158), Expect = 5.757e-11
Identity = 27/47 (57.45%), Postives = 34/47 (72.34%), Query Frame = 0
Query:    5 GYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTS 51
            G   +G   TRWTDDL+K++G  WMQ  T+RP W S+G+AYVQQWT 
Sbjct:  945 GKRSVGRPPTRWTDDLVKISGSHWMQVATDRPHWTSVGEAYVQQWTE 991          
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 64.3142 bits (155), Expect = 1.282e-10
Identity = 28/47 (59.57%), Postives = 34/47 (72.34%), Query Frame = 0
Query:    5 GYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTS 51
            G   +G   TRWTDDL+K AG RWMQ   +R  WKS+G+AYVQQWT+
Sbjct:  945 GKRSVGRPPTRWTDDLVKSAGSRWMQVAMDRSHWKSIGEAYVQQWTA 991          
BLAST of OSCA025953-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 64.3142 bits (155), Expect = 1.719e-10
Identity = 28/47 (59.57%), Postives = 34/47 (72.34%), Query Frame = 0
Query:    5 GYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWTS 51
            G   +G   TRW DDL++ AG RWMQA  +R LW+ LG+AYVQQWTS
Sbjct:  941 GRRSVGRPPTRWADDLLRFAGIRWMQAAQDRSLWRGLGEAYVQQWTS 987          
The following BLAST results are available for this feature:
BLAST of OSCA025953-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930659181|gb|KPJ01280.1|1.668e-1258.33hypothetical protein RR46_01415 [Papilio xuthus][more]
gi|134001247|gb|ABO45233.1|1.702e-1264.58reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001215|gb|ABO45231.1|1.834e-1264.58reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|1.952e-1264.58reverse transcriptase [Ostrinia nubilalis][more]
gi|909577882|ref|XP_013144778.1|1.168e-1157.14PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|825740785|ref|WP_047149388.1|1.709e-1158.33hypothetical protein, partial [Escherichia coli][more]
gi|930664358|gb|KPJ05678.1|1.993e-1160.42hypothetical protein RR46_00407 [Papilio xuthus][more]
gi|298204327|gb|ADI61812.1|5.757e-1157.45endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204325|gb|ADI61811.1|1.282e-1059.57endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204337|gb|ADI61817.1|1.719e-1059.57endonuclease-reverse transcriptase [Bombyx mori][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090304 nucleic acid metabolic process
molecular_function GO:0003824 catalytic activity
molecular_function GO:0046872 metal ion binding
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_39684contignewscf_39684:182..370 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025953-RAOSCA025953-RAOstrinia scapulalismRNAnewscf_39684 182..370 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025953-PA ID=OSCA025953-PA|Name=OSCA025953-RA|organism=Ostrinia scapulalis|type=polypeptide|length=63bp
MFLVGYNILGGTYTRWTDDLIKVAGRRWMQATTNRPLWKSLGDAYVQQWT
SYDDNNILESKTT
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0046872metal ion binding
Vocabulary: Biological Process
TermDefinition
GO:0090304nucleic acid metabolic process