OSCA025955-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025955-RA
Unique NameOSCA025955-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length59
Homology
BLAST of OSCA025955-RA vs. genbank:protein
Match: gi|913331964|ref|XP_013197583.1| (PREDICTED: uncharacterized protein LOC106140531 [Amyelois transitella])

HSP 1 Score: 69.3218 bits (168), Expect = 1.476e-13
Identity = 33/58 (56.90%), Postives = 40/58 (68.97%), Query Frame = 0
Query:    2 DHMTRKVLDIQTKPRGRGRPRITWMSVINNDLKEAQVNSKTTQDRAAWRRMMRRADPK 59
            DHMT+KVL ++   R RGRP +TWM  I NDLK   +N +TT +R  WRR  RRADPK
Sbjct:   90 DHMTKKVLSMEEGRRPRGRPPMTWMQTIKNDLKSTCINKQTTHNRVVWRRNTRRADPK 147          
BLAST of OSCA025955-RA vs. genbank:protein
Match: gi|914574553|gb|KOB76833.1| (Reverse transcriptase family member [Operophtera brumata])

HSP 1 Score: 63.929 bits (154), Expect = 8.073e-11
Identity = 30/58 (51.72%), Postives = 38/58 (65.52%), Query Frame = 0
Query:    2 DHMTRKVLDIQTKPRGRGRPRITWMSVINNDLKEAQVNSKTTQDRAAWRRMMRRADPK 59
            DHM +  LD+ T  RGRG P  TW+  +  DLKEAQ ++   QDRA WR+  R+ADPK
Sbjct:  148 DHMAKLALDLPTTRRGRGIPPSTWLKTVEKDLKEAQSDNDFAQDRAKWRKRTRKADPK 205          
BLAST of OSCA025955-RA vs. genbank:protein
Match: gi|930681322|gb|KPJ20862.1| (hypothetical protein RR48_00236 [Papilio machaon])

HSP 1 Score: 56.6102 bits (135), Expect = 2.986e-9
Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 0
Query:    2 DHMTRKVLDIQTKPRGRGRPRITWMSVINNDLKEAQVNSKTTQDRAAWRRMMRRADPK 59
            DHM +  L++ T  R RGRP  TW++ I  DLKE  ++ + +++RA WR   R+ADPK
Sbjct:   20 DHMVKLALNLPTTTRNRGRPPTTWLTTIQKDLKEIDLDEQDSRNRAVWRIRTRKADPK 77          
BLAST of OSCA025955-RA vs. genbank:protein
Match: gi|913307782|ref|XP_013184394.1| (PREDICTED: uncharacterized protein LOC106130165 [Amyelois transitella])

HSP 1 Score: 57.3806 bits (137), Expect = 5.262e-9
Identity = 31/58 (53.45%), Postives = 38/58 (65.52%), Query Frame = 0
Query:    2 DHMTRKVLDIQTKPRGRGRPRITWMSVINNDLKEAQVNSKTTQDRAAWRRMMRRADPK 59
            DHMT+KVL ++   R R RP +TWM  I NDLK   +N +T  +R  WRR  RRADPK
Sbjct:   82 DHMTKKVLSMEEGRRPRRRPPMTWMQTIKNDLKSTFINKQTNHNRVVWRRNTRRADPK 139          
The following BLAST results are available for this feature:
BLAST of OSCA025955-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 4
Match NameE-valueIdentityDescription
gi|913331964|ref|XP_013197583.1|1.476e-1356.90PREDICTED: uncharacterized protein LOC106140531 [A... [more]
gi|914574553|gb|KOB76833.1|8.073e-1151.72Reverse transcriptase family member [Operophtera b... [more]
gi|930681322|gb|KPJ20862.1|2.986e-944.83hypothetical protein RR48_00236 [Papilio machaon][more]
gi|913307782|ref|XP_013184394.1|5.262e-953.45PREDICTED: uncharacterized protein LOC106130165 [A... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_9439contignewscf_9439:2..181 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025955-RAOSCA025955-RAOstrinia scapulalismRNAnewscf_9439 2..181 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025955-PA ID=OSCA025955-PA|Name=OSCA025955-RA|organism=Ostrinia scapulalis|type=polypeptide|length=59bp
PDHMTRKVLDIQTKPRGRGRPRITWMSVINNDLKEAQVNSKTTQDRAAWR
RMMRRADPK
back to top