OSCA025956-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025956-RA
Unique NameOSCA025956-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length74
Homology
BLAST of OSCA025956-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 62.3882 bits (150), Expect = 9.714e-10
Identity = 27/39 (69.23%), Postives = 31/39 (79.49%), Query Frame = 0
Query:   17 RSVGRPPTRWTDDIVKVAGRRWTQAATNRVTWKALGRSM 55
            RSVGRPPTRWTDD+VKVAG  W QAA +R  WK+LG + 
Sbjct:  451 RSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAF 489          
BLAST of OSCA025956-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 62.3882 bits (150), Expect = 1.225e-9
Identity = 27/39 (69.23%), Postives = 31/39 (79.49%), Query Frame = 0
Query:   17 RSVGRPPTRWTDDIVKVAGRRWTQAATNRVTWKALGRSM 55
            RSVGRPPTRWTDD+VKVAG  W QAA +R  WK+LG + 
Sbjct:  432 RSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAF 470          
BLAST of OSCA025956-RA vs. genbank:protein
Match: gi|298204329|gb|ADI61813.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 61.6178 bits (148), Expect = 1.825e-9
Identity = 25/38 (65.79%), Postives = 32/38 (84.21%), Query Frame = 0
Query:   17 RSVGRPPTRWTDDIVKVAGRRWTQAATNRVTWKALGRS 54
            RSVGRPPTRWTDD+V+ AG RW + A +R+ WKALG++
Sbjct:  941 RSVGRPPTRWTDDLVRTAGSRWMRKAEDRIMWKALGKA 978          
BLAST of OSCA025956-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 61.6178 bits (148), Expect = 1.846e-9
Identity = 27/39 (69.23%), Postives = 31/39 (79.49%), Query Frame = 0
Query:   17 RSVGRPPTRWTDDIVKVAGRRWTQAATNRVTWKALGRSM 55
            RSVGRPPTRWTDD+VKVAG  W QAA +R  WK+LG + 
Sbjct:  317 RSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAF 355          
BLAST of OSCA025956-RA vs. genbank:protein
Match: gi|930663687|gb|KPJ05191.1| (hypothetical protein RR46_04028 [Papilio xuthus])

HSP 1 Score: 60.077 bits (144), Expect = 6.193e-9
Identity = 25/48 (52.08%), Postives = 32/48 (66.67%), Query Frame = 0
Query:   12 YRKTVRSVGRPPTRWTDDIVKVAGRRWTQAATNRVTWKALGRSMFSSG 59
            Y    RSVGRPP RWTDD+VKVAG  W + A +R +W++LG +    G
Sbjct:  140 YTAGPRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQG 187          
BLAST of OSCA025956-RA vs. genbank:protein
Match: gi|930660157|gb|KPJ02152.1| (hypothetical protein RR46_03427 [Papilio xuthus])

HSP 1 Score: 57.3806 bits (137), Expect = 6.440e-9
Identity = 27/53 (50.94%), Postives = 36/53 (67.92%), Query Frame = 0
Query:   17 RSVGRPPTRWTDDIVKVAGRRWTQAATNRVTWKALGRSMFSSGRPMAEMMMMM 69
            R VGRPP RWTDD+VKVAG  W Q A  R +W++LG +  SS R + + M+ +
Sbjct:   28 RIVGRPPPRWTDDLVKVAGVSWMQVAQVRSSWRSLGEAYPSSERRLRKKMLFI 80          
BLAST of OSCA025956-RA vs. genbank:protein
Match: gi|827540150|ref|XP_012553149.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101739909, partial [Bombyx mori])

HSP 1 Score: 60.077 bits (144), Expect = 7.858e-9
Identity = 28/41 (68.29%), Postives = 31/41 (75.61%), Query Frame = 0
Query:   17 RSVGRPPTRWTDDIVKVAGRRWTQAATNRVTWKALGRSMFS 57
            RSVGRPPTRWTDD+V+ AG RW Q AT+R T   L R MFS
Sbjct:  334 RSVGRPPTRWTDDLVRTAGSRWMQVATDRRTGDHLERPMFS 374          
BLAST of OSCA025956-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 59.6918 bits (143), Expect = 9.419e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 0
Query:   17 RSVGRPPTRWTDDIVKVAGRRWTQAATNRVTWKALGRS 54
            RSVGRPPTRWTDD+VK AG RW Q A +R  WK++G +
Sbjct:  947 RSVGRPPTRWTDDLVKSAGSRWMQVAMDRSHWKSIGEA 984          
The following BLAST results are available for this feature:
BLAST of OSCA025956-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 8
Match NameE-valueIdentityDescription
gi|134001323|gb|ABO45239.1|9.714e-1069.23reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|1.225e-969.23reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|298204329|gb|ADI61813.1|1.825e-965.79endonuclease-reverse transcriptase [Bombyx mori][more]
gi|134001247|gb|ABO45233.1|1.846e-969.23reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|930663687|gb|KPJ05191.1|6.193e-952.08hypothetical protein RR46_04028 [Papilio xuthus][more]
gi|930660157|gb|KPJ02152.1|6.440e-950.94hypothetical protein RR46_03427 [Papilio xuthus][more]
gi|827540150|ref|XP_012553149.1|7.858e-968.29PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|298204325|gb|ADI61811.1|9.419e-965.79endonuclease-reverse transcriptase [Bombyx mori][more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2042contignewscf_2042:567..791 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025956-RAOSCA025956-RAOstrinia scapulalismRNAnewscf_2042 567..791 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025956-PA ID=OSCA025956-PA|Name=OSCA025956-RA|organism=Ostrinia scapulalis|type=polypeptide|length=74bp
MGQQGSGVKAAYRKTVRSVGRPPTRWTDDIVKVAGRRWTQAATNRVTWKA
LGRSMFSSGRPMAEMMMMMNDETI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity