OSCA025957-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025957-RA
Unique NameOSCA025957-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length44
Homology
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|357630243|gb|EHJ78503.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 67.0106 bits (162), Expect = 8.121e-12
Identity = 31/41 (75.61%), Postives = 33/41 (80.49%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPI 41
            QTWRRT+  E K IGKTWS+IK EAQDR RWR  VDALCPI
Sbjct:  790 QTWRRTIIAEVKNIGKTWSDIKGEAQDRTRWRRTVDALCPI 830          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|357617567|gb|EHJ70865.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 66.6254 bits (161), Expect = 1.112e-11
Identity = 31/41 (75.61%), Postives = 33/41 (80.49%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPI 41
            QTWRRT+  E K IGKTWS+IK EAQDR RWR  VDALCPI
Sbjct:  531 QTWRRTIIAEVKNIGKTWSDIKGEAQDRTRWRRTVDALCPI 571          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|930662995|gb|KPJ04618.1| (hypothetical protein RR46_03229, partial [Papilio xuthus])

HSP 1 Score: 61.6178 bits (148), Expect = 1.118e-11
Identity = 30/44 (68.18%), Postives = 31/44 (70.45%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT 44
            QTWRR+VA E K IG TW E KR  QDR  WR  VDALCPI GT
Sbjct:   22 QTWRRSVAAEIKAIGLTWPETKRRVQDRANWRRTVDALCPIAGT 65          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|930654879|gb|KPI97211.1| (hypothetical protein RR46_09118, partial [Papilio xuthus])

HSP 1 Score: 61.2326 bits (147), Expect = 1.901e-11
Identity = 29/44 (65.91%), Postives = 31/44 (70.45%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT 44
            QTWRR+VA E K IG TW E KR AQDR  WR  +DALCP  GT
Sbjct:   32 QTWRRSVAAEMKAIGLTWPETKRRAQDRANWRRTMDALCPTTGT 75          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|930662147|gb|KPJ03943.1| (Membralin [Papilio xuthus])

HSP 1 Score: 65.4698 bits (158), Expect = 2.312e-11
Identity = 28/44 (63.64%), Postives = 30/44 (68.18%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT 44
            QTWR +VA + K IG TW E KR AQDR  WR  VDALCP  GT
Sbjct:  501 QTWRLSVAADMKAIGLTWPETKRRAQDRANWRRTVDALCPTTGT 544          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|930653388|gb|KPI95725.1| (hypothetical protein RR46_11438 [Papilio xuthus])

HSP 1 Score: 60.077 bits (144), Expect = 4.232e-11
Identity = 29/43 (67.44%), Postives = 30/43 (69.77%), Query Frame = 0
Query:    2 TWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT 44
            TWRR+VA E K IG TW E KR AQDR  WR  VDALCP  GT
Sbjct:   12 TWRRSVAAEMKAIGLTWPETKRRAQDRANWRRTVDALCPTAGT 54          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|357611937|gb|EHJ67725.1| (hypothetical protein KGM_22598 [Danaus plexippus])

HSP 1 Score: 58.9214 bits (141), Expect = 8.980e-11
Identity = 28/41 (68.29%), Postives = 32/41 (78.05%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPI 41
            QTW RT+  E K IGKTWS++K EA+DR RWR  VDALCPI
Sbjct:    2 QTWWRTIIAEVKNIGKTWSDMKGEAKDRTRWRRTVDALCPI 42          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|910342320|ref|XP_013174897.1| (PREDICTED: uncharacterized protein LOC106123211 [Papilio xuthus])

HSP 1 Score: 63.1586 bits (152), Expect = 1.496e-10
Identity = 28/44 (63.64%), Postives = 30/44 (68.18%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT 44
            QTWRR++A E K IG TW E KR  QDR  WR  VDALCP  GT
Sbjct:  379 QTWRRSIAAEMKAIGLTWPETKRRFQDRANWRRTVDALCPTAGT 422          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|930675421|gb|KPJ15680.1| (hypothetical protein RR48_05644 [Papilio machaon])

HSP 1 Score: 58.151 bits (139), Expect = 3.332e-10
Identity = 27/44 (61.36%), Postives = 31/44 (70.45%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT 44
            Q WRR+VA + K +G TW E KR  QDR+RWR  VDALCP  GT
Sbjct:   24 QIWRRSVAADMKTVGLTWLETKRRTQDRVRWRRTVDALCPTTGT 67          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|930648946|gb|KPI91294.1| (hypothetical protein RR46_14798, partial [Papilio xuthus])

HSP 1 Score: 56.9954 bits (136), Expect = 6.228e-10
Identity = 28/44 (63.64%), Postives = 30/44 (68.18%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT 44
            QTWRR+VA + K IG TW E KR AQDR  WR  V ALCP  GT
Sbjct:    6 QTWRRSVAADMKTIGLTWPETKRRAQDRANWRRTVVALCPTSGT 49          
The following BLAST results are available for this feature:
BLAST of OSCA025957-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 15
Match NameE-valueIdentityDescription
gi|357630243|gb|EHJ78503.1|8.121e-1275.61endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357617567|gb|EHJ70865.1|1.112e-1175.61endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|930662995|gb|KPJ04618.1|1.118e-1168.18hypothetical protein RR46_03229, partial [Papilio ... [more]
gi|930654879|gb|KPI97211.1|1.901e-1165.91hypothetical protein RR46_09118, partial [Papilio ... [more]
gi|930662147|gb|KPJ03943.1|2.312e-1163.64Membralin [Papilio xuthus][more]
gi|930653388|gb|KPI95725.1|4.232e-1167.44hypothetical protein RR46_11438 [Papilio xuthus][more]
gi|357611937|gb|EHJ67725.1|8.980e-1168.29hypothetical protein KGM_22598 [Danaus plexippus][more]
gi|910342320|ref|XP_013174897.1|1.496e-1063.64PREDICTED: uncharacterized protein LOC106123211 [P... [more]
gi|930675421|gb|KPJ15680.1|3.332e-1061.36hypothetical protein RR48_05644 [Papilio machaon][more]
gi|930648946|gb|KPI91294.1|6.228e-1063.64hypothetical protein RR46_14798, partial [Papilio ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_43776contignewscf_43776:472..606 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025957-RAOSCA025957-RAOstrinia scapulalismRNAnewscf_43776 472..606 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025957-PA ID=OSCA025957-PA|Name=OSCA025957-RA|organism=Ostrinia scapulalis|type=polypeptide|length=44bp
QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity