OSCA025957-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025957-RA
Unique NameOSCA025957-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length44
Homology
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|930681965|gb|KPJ21505.1| (hypothetical protein RR48_01341 [Papilio machaon])

HSP 1 Score: 55.8398 bits (133), Expect = 1.292e-9
Identity = 26/43 (60.47%), Postives = 31/43 (72.09%), Query Frame = 0
Query:    2 TWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT 44
            TWRR+VA + K +G TW + KR AQDR+ WR  VDALCP  GT
Sbjct:    2 TWRRSVAADMKTVGLTWLQSKRRAQDRVSWRRTVDALCPTTGT 44          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|357607528|gb|EHJ65566.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 60.077 bits (144), Expect = 1.966e-9
Identity = 28/41 (68.29%), Postives = 31/41 (75.61%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPI 41
            QTWRRT+  E K I KTWS++K EAQDR RWR   DALCPI
Sbjct:  774 QTWRRTITAEVKNIDKTWSDMKGEAQDRTRWRRTGDALCPI 814          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|357628648|gb|EHJ77911.1| (putative matriptase-like protein [Danaus plexippus])

HSP 1 Score: 57.3806 bits (137), Expect = 2.272e-9
Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPI 41
            QTWRRT+  EAK +GKTWS+++ EAQ R R R  +DALCPI
Sbjct:   80 QTWRRTIIAEAKNVGKTWSDMQGEAQYRTRRRRTMDALCPI 120          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|910338279|ref|XP_013172736.1| (PREDICTED: uncharacterized protein LOC106121570 [Papilio xuthus])

HSP 1 Score: 58.9214 bits (141), Expect = 5.178e-9
Identity = 29/44 (65.91%), Postives = 30/44 (68.18%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT 44
            QTW R+VA E K IG TW E KR AQDR  WR  VDALCP  GT
Sbjct:  558 QTWWRSVAAEMKAIGLTWPETKRRAQDRANWRRAVDALCPTAGT 601          
BLAST of OSCA025957-RA vs. genbank:protein
Match: gi|930681261|gb|KPJ20801.1| (hypothetical protein RR46_00019 [Papilio xuthus])

HSP 1 Score: 54.6842 bits (130), Expect = 7.667e-9
Identity = 26/40 (65.00%), Postives = 27/40 (67.50%), Query Frame = 0
Query:    1 QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCP 40
            QTWRR+VA   K IG TWSE KR AQDR  WR  VD  CP
Sbjct:   30 QTWRRSVAANMKAIGLTWSETKRRAQDRANWRHTVDIPCP 69          
The following BLAST results are available for this feature:
BLAST of OSCA025957-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 15
Match NameE-valueIdentityDescription
gi|930681965|gb|KPJ21505.1|1.292e-960.47hypothetical protein RR48_01341 [Papilio machaon][more]
gi|357607528|gb|EHJ65566.1|1.966e-968.29endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357628648|gb|EHJ77911.1|2.272e-963.41putative matriptase-like protein [Danaus plexippus... [more]
gi|910338279|ref|XP_013172736.1|5.178e-965.91PREDICTED: uncharacterized protein LOC106121570 [P... [more]
gi|930681261|gb|KPJ20801.1|7.667e-965.00hypothetical protein RR46_00019 [Papilio xuthus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_43776contignewscf_43776:472..606 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025957-RAOSCA025957-RAOstrinia scapulalismRNAnewscf_43776 472..606 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025957-PA ID=OSCA025957-PA|Name=OSCA025957-RA|organism=Ostrinia scapulalis|type=polypeptide|length=44bp
QTWRRTVADEAKKIGKTWSEIKREAQDRMRWRTVVDALCPIXGT
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity