OSCA025959-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025959-RA
Unique NameOSCA025959-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length124
Homology
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|1061795256|dbj|BAV56788.1| (odorant binding protein 1 [Ostrinia furnacalis])

HSP 1 Score: 235.343 bits (599), Expect = 3.836e-78
Identity = 114/124 (91.94%), Postives = 119/124 (95.97%), Query Frame = 0
Query:    1 TALAARAWGMDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            TALAARAWGMDDEMAELAKMLHDNCGEETGVDLGLVD+VNAGADLMPDAKLKCYIKC+METAGMMSAGE+DVEAVLA+LPD LR K EA +RACGTQRGADDCDTAFLTQVCWQKANK DYFLI
Sbjct:   11 TALAARAWGMDDEMAELAKMLHDNCGEETGVDLGLVDKVNAGADLMPDAKLKCYIKCVMETAGMMSAGEVDVEAVLAMLPDGLRSKIEAPMRACGTQRGADDCDTAFLTQVCWQKANKVDYFLI 134          
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|507155159|gb|AGM38607.1| (odorant binding protein [Chilo suppressalis])

HSP 1 Score: 212.616 bits (540), Expect = 4.632e-69
Identity = 101/123 (82.11%), Postives = 110/123 (89.43%), Query Frame = 0
Query:    2 ALAARAWGMDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            A  A AW MD+EMAELAKMLHDNCGEETG DL LVD+VNAGADLMPD KLKCY+KCIMETAGMM+ G +DVEAVLALLPDD+R KNE +LR CGTQ+GAD CDTAFLTQ+CWQKANKADYFLI
Sbjct:   11 AFVAGAWAMDEEMAELAKMLHDNCGEETGADLSLVDKVNAGADLMPDPKLKCYLKCIMETAGMMTEGVVDVEAVLALLPDDMRAKNEQNLRGCGTQKGADHCDTAFLTQLCWQKANKADYFLI 133          
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|482612758|gb|AGK24582.1| (antennal-binding protein X [Chilo suppressalis])

HSP 1 Score: 211.075 bits (536), Expect = 1.582e-68
Identity = 100/123 (81.30%), Postives = 110/123 (89.43%), Query Frame = 0
Query:    2 ALAARAWGMDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            A  A AW MD+EMAELAKMLHDNCGEETG DL LVD+VNAGADLMPD KLKCY+KCIMETAGMM+ G +DVEAVLALLPDD+R KNE +LR CGTQ+GAD CDTA+LTQ+CWQKANKADYFLI
Sbjct:   11 AFVAGAWAMDEEMAELAKMLHDNCGEETGADLSLVDKVNAGADLMPDPKLKCYLKCIMETAGMMTEGVVDVEAVLALLPDDMRAKNEQNLRGCGTQKGADHCDTAYLTQLCWQKANKADYFLI 133          
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|1031599620|gb|ANG08529.1| (odorant-binding protein 31, partial [Plutella xylostella])

HSP 1 Score: 203.371 bits (516), Expect = 1.807e-65
Identity = 95/122 (77.87%), Postives = 105/122 (86.07%), Query Frame = 0
Query:    3 LAARAWGMDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            L      MD+EMAELAKM+ DNCG ET VD+GL+DQVN GADLMPD KLKCYIKC+METAGMMS GE+DVEAVLALLP+D + KNE SLRACGTQ+GADDCDTAF TQ CWQKANKADYFL+
Sbjct:   15 LVVSVSAMDEEMAELAKMIRDNCGAETEVDMGLIDQVNGGADLMPDGKLKCYIKCVMETAGMMSEGEVDVEAVLALLPEDFKAKNEKSLRACGTQKGADDCDTAFQTQACWQKANKADYFLV 136          
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|768413258|ref|XP_011568741.1| (PREDICTED: general odorant-binding protein 69a-like [Plutella xylostella])

HSP 1 Score: 202.216 bits (513), Expect = 5.973e-65
Identity = 94/115 (81.74%), Postives = 104/115 (90.43%), Query Frame = 0
Query:   10 MDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            MD+EMAELAKM+ DNCG ET VD+GL+DQVN GADLMPD KLKCYIKC+METAGMMS GE+DVEAVLALLP+D + KNE SLRACGTQ+GADDCDTAF TQ CWQKANKADYFL+
Sbjct:   22 MDEEMAELAKMIRDNCGAETEVDMGLIDQVNGGADLMPDGKLKCYIKCVMETAGMMSEGEVDVEAVLALLPEDFKAKNEKSLRACGTQKGADDCDTAFQTQACWQKANKADYFLV 136          
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|859108979|gb|JAI18229.1| (Antennal Binding Protein X [Epiphyas postvittana])

HSP 1 Score: 200.675 bits (509), Expect = 2.155e-64
Identity = 97/123 (78.86%), Postives = 108/123 (87.80%), Query Frame = 0
Query:    2 ALAARAWGMDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            AL   A  MD+EMAELAKMLHDNCGEETG DL LVD+VNAGADLMPD KLKCYIKCIMETAGM++ GE+DVEAV+ALLP+D+  KN  +LR CGTQ+GADDCDTAFLTQVCWQ ANKA+YFLI
Sbjct:   14 ALVLGAHCMDEEMAELAKMLHDNCGEETGADLSLVDKVNAGADLMPDPKLKCYIKCIMETAGMLTDGEVDVEAVIALLPEDMAAKNGPALRKCGTQKGADDCDTAFLTQVCWQTANKAEYFLI 136          
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|925175944|gb|ALC79591.1| (odorant binding protein 11 [Grapholita molesta])

HSP 1 Score: 198.749 bits (504), Expect = 1.437e-63
Identity = 92/115 (80.00%), Postives = 104/115 (90.43%), Query Frame = 0
Query:   10 MDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            MDDEMAEL KML DNCGEETGVDL LV++VN GADLMPD KLKCY KCIMETAGM S GE+DVEAV+ALLP+D++ KNE ++RACGTQ+G DDC+TAFLTQVCWQKANKADYFL+
Sbjct:   21 MDDEMAELMKMLRDNCGEETGVDLSLVEKVNQGADLMPDPKLKCYTKCIMETAGMFSEGEVDVEAVVALLPEDMKTKNEKNIRACGTQKGGDDCETAFLTQVCWQKANKADYFLV 135          
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|1059519777|gb|AOG12857.1| (odorant binding protein [Eogystia hippophaecolus])

HSP 1 Score: 195.667 bits (496), Expect = 2.204e-62
Identity = 89/115 (77.39%), Postives = 107/115 (93.04%), Query Frame = 0
Query:   10 MDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            MD+EMAELA+ML +NCGEETGVDLGLVDQVN GADLMPD KLKCYIKC+METAGM S G+++VEAV+A+LP+++ +K+E S+R CGTQ+GADDCDTAFLTQVCWQKANKA+YFL+
Sbjct:   22 MDEEMAELARMLRENCGEETGVDLGLVDQVNGGADLMPDPKLKCYIKCVMETAGMFSEGQVEVEAVIAMLPENM-KKSEGSIRGCGTQKGADDCDTAFLTQVCWQKANKAEYFLV 135          
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|260657056|gb|ACX47898.1| (antennal binding protein X, partial [Amyelois transitella])

HSP 1 Score: 193.356 bits (490), Expect = 8.970e-62
Identity = 93/117 (79.49%), Postives = 103/117 (88.03%), Query Frame = 0
Query:   10 MDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADL--MPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            MDDEMAELAKM+HDNCGEETG DL  VD+VNAGADL   PD KLKCYIKCIMETAGMM+ GE+DVEAVLA+LPD++R +NEA++R CGTQRGAD CD AFLT VCWQKANK DYFLI
Sbjct:    1 MDDEMAELAKMVHDNCGEETGADLAPVDKVNAGADLADFPDPKLKCYIKCIMETAGMMTDGEVDVEAVLAMLPDEVRGRNEAAMRGCGTQRGADHCDNAFLTHVCWQKANKKDYFLI 117          
BLAST of OSCA025959-RA vs. genbank:protein
Match: gi|380084990|gb|AFD34174.1| (antennal binding protein X [Argyresthia conjugella])

HSP 1 Score: 193.741 bits (491), Expect = 1.316e-61
Identity = 88/115 (76.52%), Postives = 103/115 (89.57%), Query Frame = 0
Query:   10 MDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAKLKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGADDCDTAFLTQVCWQKANKADYFLI 124
            MD EMAELAKM+ DNCG ETGVD+GL+D+VNAGADL PD KLKCYIKC+METAGM+S GE+DVEAVLALLPDD+R KNEA+ R CGTQ+G DDCDTA+ TQ CWQK+NKA++FL+
Sbjct:   22 MDPEMAELAKMIRDNCGAETGVDIGLIDKVNAGADLTPDPKLKCYIKCVMETAGMLSEGEVDVEAVLALLPDDMRAKNEAAFRXCGTQKGTDDCDTAYKTQECWQKSNKAEFFLV 136          
The following BLAST results are available for this feature:
BLAST of OSCA025959-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1061795256|dbj|BAV56788.1|3.836e-7891.94odorant binding protein 1 [Ostrinia furnacalis][more]
gi|507155159|gb|AGM38607.1|4.632e-6982.11odorant binding protein [Chilo suppressalis][more]
gi|482612758|gb|AGK24582.1|1.582e-6881.30antennal-binding protein X [Chilo suppressalis][more]
gi|1031599620|gb|ANG08529.1|1.807e-6577.87odorant-binding protein 31, partial [Plutella xylo... [more]
gi|768413258|ref|XP_011568741.1|5.973e-6581.74PREDICTED: general odorant-binding protein 69a-lik... [more]
gi|859108979|gb|JAI18229.1|2.155e-6478.86Antennal Binding Protein X [Epiphyas postvittana][more]
gi|925175944|gb|ALC79591.1|1.437e-6380.00odorant binding protein 11 [Grapholita molesta][more]
gi|1059519777|gb|AOG12857.1|2.204e-6277.39odorant binding protein [Eogystia hippophaecolus][more]
gi|260657056|gb|ACX47898.1|8.970e-6279.49antennal binding protein X, partial [Amyelois tran... [more]
gi|380084990|gb|AFD34174.1|1.316e-6176.52antennal binding protein X [Argyresthia conjugella... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005549 odorant binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006170Pheromone/general odorant binding proteinSMARTSM00708PhBPcoord: 21..117
e-value: 3.4E-28
score: 109.7
IPR006170Pheromone/general odorant binding proteinPFAMPF01395PBP_GOBPcoord: 12..118
e-value: 5.6E-19
score: 67.8
IPR023316Pheromone/general odorant binding protein, PBP/GOBP, domainGENE3D1.10.238.20coord: 11..123
e-value: 3.3E-29
score: 100.7
IPR023316Pheromone/general odorant binding protein, PBP/GOBP, domainSUPERFAMILY47565Insect pheromone/odorant-binding proteinscoord: 12..123
NoneNo IPR availablePANTHERPTHR11857ODORANT BINDING PROTEIN-RELATEDcoord: 1..124

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_23838contignewscf_23838:3..377 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025959-RAOSCA025959-RAOstrinia scapulalismRNAnewscf_23838 3..377 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025959-PA ID=OSCA025959-PA|Name=OSCA025959-RA|organism=Ostrinia scapulalis|type=polypeptide|length=124bp
TALAARAWGMDDEMAELAKMLHDNCGEETGVDLGLVDQVNAGADLMPDAK
LKCYIKCIMETAGMMSAGEMDVEAVLALLPDDLRRKNEASLRACGTQRGA
DDCDTAFLTQVCWQKANKADYFLI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005549odorant binding
Vocabulary: INTERPRO
TermDefinition
IPR023316PBP_GOBP_dom
IPR006170PBP_GOBP